KEGG   Erythrobacter litoralis HTCC2594: ELI_11410Help
Entry
ELI_11410         CDS       T00315                                 

Definition
(GenBank) homoserine acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli00270  Cysteine and methionine metabolism
eli00920  Sulfur metabolism
eli01100  Metabolic pathways
eli01110  Biosynthesis of secondary metabolites
eli01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:eli00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ELI_11410
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ELI_11410
Enzymes [BR:eli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     ELI_11410
    2.3.1.46  homoserine O-succinyltransferase
     ELI_11410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Esterase Abhydrolase_6 Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: ABC64374
UniProt: Q2N7G7
Position
complement(2305897..2306991)
Genome map
AA seq 364 aa AA seqDB search
MSNPHTSLTLPNPLPLDSGQALACVEMAYETYGTLNADKSNAILICHALTGDQYVASTHP
ITGKPGWWERMVGPGKPIDTDRFHVICANVIGSCLGSTGPQSPASDGEPYAMRFPVITIR
DMVRGLVAMLDAMGIAQLHTVVGGSMGGMQALSLAANWPDRAGRVLAIATTARHSAQNIA
FHEVGRQAIMADPHWCGGDYYGEESAPDAGLAVARMAAHITYLSEEGLTEKFGRRLQDRD
AKTFGFDADFQVESYLRYQGSGFTRRFDANSYLYITRAMDYFDIAEEHGGTLAKAFAGTP
ARFCLVSFDSDWLYPTAESRHVVHALNAAGAPVSFVELSAPFGHDSFLLDVPALDRVVKG
FLDG
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
ttgagcaacccgcacaccagcctgacccttccgaaccccctgccgctcgacagcgggcag
gcgctcgcgtgcgtcgagatggcctacgagacctatggcaccctgaatgcggacaagagc
aacgcgatcctgatctgccatgcgctgaccggcgaccagtatgtcgccagcacccacccg
atcaccggcaagcccggctggtgggagcggatggtggggccgggcaagccgatcgatacc
gaccgcttccacgtcatctgcgccaacgtcatcggtagctgcctcggttcgacgggcccg
caaagccccgcgtccgacggcgagccctatgccatgcgctttcccgtcatcacgatccgc
gacatggtgcgcggattggtggctatgctcgatgcgatgggtatcgcgcagctgcacacc
gtcgtcggcggatcgatgggcgggatgcaggcgctgagccttgctgccaattggccggat
cgggccggacgggtgctggcgatcgcgaccaccgcacggcattcggcgcagaacatcgcc
ttccacgaagtcgggcggcaggcgatcatggccgatcctcactggtgcggcggtgactat
tatggcgaggaatcagcgcccgatgccggtctcgcggttgcgcggatggcggcgcacatc
acctatctttccgaagaagggctgacagagaaattcgggcggcggttgcaggatcgcgat
gccaagaccttcgggttcgatgcggatttccaggtcgagagctaccttcgctatcagggc
agcggcttcacccgccggttcgatgccaacagctacctctacatcacccgcgcgatggac
tatttcgacatcgccgaagagcacggcggcacgctcgccaaggcattcgccggcacgcct
gcgcgattctgcctcgtcagcttcgacagcgactggctctatcccacggcggaaagccgc
catgtggtgcacgcgctcaatgcggcgggcgcgcctgtcagcttcgtcgagctttccgcc
cccttcggtcacgacagcttcctgctcgacgttcccgcgctcgaccgggtggtgaaaggc
ttcctcgatggctga

DBGET integrated database retrieval system