KEGG   Erythrobacter litoralis HTCC2594: ELI_11825Help
Entry
ELI_11825         CDS       T00315                                 

Definition
(GenBank) uridylyltransferase
  KO
K00990  [protein-PII] uridylyltransferase [EC:2.7.7.59]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eli00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ELI_11825
Enzymes [BR:eli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.59  [protein-PII] uridylyltransferase
     ELI_11825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnD_UR_UTase HD ACT DUF294 GlnE ACT_6 NTP_transf_2
Motif
Other DBs
NCBI-ProteinID: ABC64457
UniProt: Q2N784
Position
2381548..2384307
Genome map
AA seq 919 aa AA seqDB search
MTDPKVPRQRRIIDRRKLAAAVEALAEQQGEKARPAVLKVLREALEKGRDELSQRLLDRP
SAGHQITAGHAFLVDQLVRVIFDHVTTHLYPVANRSSSERIAVLAVGGYGRAEMAPQSDV
DIAFLHPSRRTPWCEQVTEAMLYFLWDLGFKVGQSSRTPEDMVRMAREDLTIRTALLEAR
FVWGDRELYDEARKRFWSEVVNGTERQFVAEKLAERDARHERMGGTRYVVEPNVKEGKGG
LRDLQTLYWIGKYIHRARGAAELVDAGLLTETEYHGFRRAEGFLLAVRCHLHEITGRPED
RLTFDFQKQIAERMRFAERREKSAVERFMQYYFLQVKRVGSLTGVFLAQMDQQFARKRAR
TGLLAGFNAKSRMLKGYTVFGGKIAAPGDNWFRDDPVRLIEIFQLAEANGLEIDPRSMRQ
ADRDSVLIKDQVRNDPRANAIFLDLLCGRNDPETALRWMNEAGVFGKFVPDFGRVNAQMQ
FNMYHHYTVDEHTIRAIGFLSKIEKGELAKEHPRSTREIHKVKSRRVAFVAALLHDIAKG
RGGDHSILGAEVAEELCPRFGLDEDETDLVAWLVLQHLLMSSTAQKRDLTDPKTIEDFVA
EVQSLERLRHLAILTSVDIRAVGPGTWNSWKGQLLGELYDAAHERLRLGHMKHHRSERVA
AKKEAVREALGGKAALLEKHGRLLPDSYWIAEPENVISRNIVQYDVAREISEDLSIHCEF
DEERGATLVTVIAADHPGLFYRIAGGIHLAGGNIIDARIHTTRNGWAIDNYLVQDPVGQP
FAEERQLARIEQAIADAIANRGELVPKLAKRPLKQTRAGAFDVRPRVLFDNDASGRFTVI
EVNARDRAALLNRLGRALFENQVIVQSAHITAYGERAADTFYVTDLTGAKITDESRMDTI
RQALLDAASDARQAELEPA
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgaccccaaggtcccccgccaacgccgcatcatcgaccgtcgcaaactcgctgcg
gcggtcgaagcactagccgagcagcagggcgagaaggcccgcccggcggtcctgaaagta
ctgcgcgaggcgctggagaagggtcgcgacgaactgtcgcagcggctgctcgaccggccg
agcgccgggcaccagatcaccgccggtcacgcgtttctggtcgaccagctggtgcgggtg
atcttcgaccatgtcaccacgcatctctatcccgtagccaatcgttcctcgtcggaacgg
atcgcggtcctcgcggtcggcggatatggccgcgcggagatggcgccgcagtccgatgtc
gacatcgccttcctgcacccctcgcggcgaacgccctggtgcgagcaggtgaccgaggcg
atgctctatttcctgtgggacctcggcttcaaggtcggccaatcaagccgcacccccgaa
gacatggtgcgcatggccagggaagatctcaccatccgcaccgcgctgctcgaagcgcgc
ttcgtctggggcgaccgcgaactctacgacgaggcgcgcaagcgcttctggagcgaagtc
gtcaacggtacagagcggcaattcgtcgccgaaaagctcgccgaacgcgatgcgcggcac
gagcggatggggggcacgcgctacgtcgtcgagcccaacgtcaaggaaggcaagggcggc
ctgcgcgacctgcagacgctttactggatcggcaaatacatccaccgcgcgcgcggagcc
gccgagctggtcgatgccgggctgctgaccgagacggaatatcacgggttccggcgcgcc
gaaggattcctgctggcggtgcgctgtcacctgcacgagatcaccgggcggcccgaagac
cggctgaccttcgatttccagaaacagatcgccgagcgcatgcgctttgccgaacggcgc
gagaagagcgcggtcgaacggttcatgcagtattatttcctgcaggtgaaacgcgtcggc
tcgctgaccggcgtattcctggcgcagatggaccagcaattcgcccgcaagcgcgcgcgc
accggcctgctggcgggcttcaacgccaaatcgcgcatgctcaagggctatacggtattc
ggcggcaagatcgccgcgcccggcgacaactggttccgcgacgatccagtgcggctgatc
gaaatcttccagctcgccgaagccaacgggctggagatcgatccgcgcagcatgcgccag
gccgatcgcgacagcgtgctgatcaaggaccaggtgcgcaacgacccgcgcgccaatgcc
atcttcctcgacctgctgtgcgggcgcaacgatccggagaccgcgctgcgctggatgaac
gaggcgggcgtgttcggaaagttcgtgcccgatttcggccgcgtcaacgcgcagatgcag
ttcaacatgtaccaccactacacggtggacgagcacaccatccgcgcgatcgggttcctc
tccaagatcgagaagggcgagctggccaaggagcatccgcgctcgacgcgcgagattcac
aaggtcaagagccgccgcgtcgctttcgtcgcggcgctgctgcacgatatcgccaagggg
cgcggaggcgaccattcgatcctcggggcggaagtggccgaggaactgtgcccccgtttc
gggctcgacgaagacgagaccgatctggtcgcgtggctggtgttgcagcacctgctgatg
agctcgaccgcgcagaagcgcgacctgaccgaccccaagacgatcgaggatttcgtcgcc
gaggtgcagagcctcgagcggctgcgccatctcgcgatcctgaccagcgtcgatatccgt
gcggtcggtccggggacatggaacagctggaagggccagttgctgggcgagctctacgat
gccgcgcacgaacggctccggctcggccatatgaagcatcatcgctccgaacgcgtggca
gcgaagaaagaggccgtgcgcgaggccttgggcggcaaggcggcgctgctggaaaagcat
ggcaggctgctgcccgattcctactggatcgccgaaccggaaaacgtgatctcgcgcaat
atcgtccagtacgacgtcgcccgcgagatcagcgaggacctgtcgatccattgcgaattc
gacgaggaacgcggcgcgacgctggtcacggtcatcgccgccgaccatccgggcctgttc
tatcgcattgccggaggcattcacctggctggcggcaacatcatcgatgcccgtattcac
acgacccgcaacggctgggcgatcgacaattacctggtgcaggacccggtcggccaaccc
tttgccgaagagcggcaacttgcccggatcgagcaggccatcgccgatgccattgccaat
cgcggcgaactggtgcccaagctcgccaagcgtccgctcaagcagacccgggccggcgcc
ttcgacgtccgcccgcgcgtcctgttcgacaacgatgcttcgggtcggttcaccgtgatc
gaagtcaacgcccgcgaccgggccgcgctgctcaaccggctgggccgcgcgctgttcgaa
aaccaggtcatagtccagtcggcccacatcaccgcctatggcgagcgggcggccgatacg
ttctatgtcaccgacctcacaggcgccaagatcacagacgaaagccgcatggacacgatc
cggcaggccctgctcgatgccgcgagcgacgcgcggcaggccgagctcgaaccggcctga

DBGET integrated database retrieval system