KEGG   Erythrobacter litoralis HTCC2594: ELI_12090Help
Entry
ELI_12090         CDS       T00315                                 

Definition
(GenBank) putative 3-ketoacyl-CoA thiolase/acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli00071  Fatty acid degradation
eli00072  Synthesis and degradation of ketone bodies
eli00280  Valine, leucine and isoleucine degradation
eli00310  Lysine degradation
eli00362  Benzoate degradation
eli00380  Tryptophan metabolism
eli00620  Pyruvate metabolism
eli00630  Glyoxylate and dicarboxylate metabolism
eli00640  Propanoate metabolism
eli00650  Butanoate metabolism
eli00900  Terpenoid backbone biosynthesis
eli01100  Metabolic pathways
eli01110  Biosynthesis of secondary metabolites
eli01120  Microbial metabolism in diverse environments
eli01130  Biosynthesis of antibiotics
eli01200  Carbon metabolism
eli01212  Fatty acid metabolism
eli02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ELI_12090
   00630 Glyoxylate and dicarboxylate metabolism
    ELI_12090
   00640 Propanoate metabolism
    ELI_12090
   00650 Butanoate metabolism
    ELI_12090
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ELI_12090
   00072 Synthesis and degradation of ketone bodies
    ELI_12090
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ELI_12090
   00310 Lysine degradation
    ELI_12090
   00380 Tryptophan metabolism
    ELI_12090
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ELI_12090
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ELI_12090
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ELI_12090
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eli04147]
    ELI_12090
Enzymes [BR:eli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ELI_12090
Exosome [BR:eli04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ELI_12090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABC64510
UniProt: Q2N731
Position
complement(2438930..2440111)
Genome map
AA seq 393 aa AA seqDB search
MSRDAVIVSTARTPIGRAYKGGFNATPGATLGSFSLAPAVERAGIEGGEIDDVVWGCVLT
QGTQSGNIGRQVALRAGLPVSVAAQTIDRQCSSGLMAISTAAKQIIVDNMDIVVGGGQDS
ISMVQTPEMRVAPDKSLIAMHKDVYMPMLQTAETVAERYGISREAQDEYALQSQMRTAAG
QEAGKFDDEIVPVNTTMMVKDKETGEVSSQEVTITKDEGNRPSTTLEGLQSLNPVMGPDK
VITAGNASQLSDGSSASVLMEAKVAEQKGLEPLGRYVGMAVAGTEPDEMGIGPVFAIPKL
LEQTGIKHDDVGLWELNEAFAVQVLYCRDKLGIDNDILNVNGGSISIGHPYGMTGARCVG
HALIEGKRRGAKYVVVTMCVGGGMGAAGMFEVF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtgacgcagtcatcgtttccaccgcccgcacccctatcggccgcgcctacaag
ggcggcttcaatgccacccccggcgcgacgctcggttcgttctcgcttgccccggcagtc
gaacgcgccgggatcgaaggcggcgagatcgacgatgtcgtgtggggctgcgtcctcacc
cagggtacccagtcgggcaatatcggccgccaggtcgcgctgcgtgcgggtcttcccgtc
agcgtcgcggcgcagacgatcgaccgccagtgctcctcgggcctgatggcgatcagcacc
gcggccaagcagatcatcgtcgacaatatggatatcgtcgtcggcggcggtcaggattcg
atttcgatggtccagaccccggaaatgcgcgtcgcgcccgacaagtcgctgatcgcgatg
cacaaggatgtctacatgccgatgctccagaccgccgagacggtggccgagcgctacggc
atcagccgcgaagcgcaggacgaatacgcgctgcagtcgcagatgcgcaccgccgccggg
caggaagcgggcaagttcgacgacgagatcgtgccggtcaacaccaccatgatggtgaag
gacaaggagacgggcgaagtctccagccaggaagtcaccatcaccaaggatgaaggcaac
cgcccctcgaccacgctggaagggctgcagtcgctaaatccggtcatgggcccggacaag
gtcatcaccgccggtaacgcttcgcagctctcggacgggtcctcggccagcgtgctgatg
gaagcgaaggttgccgagcagaagggcctcgagccgctcggtcgctatgtcggcatggcg
gtggcggggacggagcccgacgaaatgggcatcggcccggtcttcgcgatccccaagctg
ctcgaacagaccggcatcaagcacgacgacgtcggcctgtgggaattgaacgaagccttc
gcggtgcaggtcctctattgccgcgacaagctcgggatcgacaacgatatcctcaacgtc
aacggcggctcgatctcgatcggccacccctacggcatgaccggcgcgcgctgcgtcggc
cacgcgctgatcgaaggcaagcgccgcggcgcgaaatatgtcgtcgtcaccatgtgcgtc
ggtggcggcatgggcgctgcgggcatgttcgaggtgttttaa

DBGET integrated database retrieval system