KEGG   Erythrobacter litoralis HTCC2594: ELI_13520Help
Entry
ELI_13520         CDS       T00315                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
eli  Erythrobacter litoralis HTCC2594
Pathway
eli00020  Citrate cycle (TCA cycle)
eli00640  Propanoate metabolism
eli00660  C5-Branched dibasic acid metabolism
eli01100  Metabolic pathways
eli01110  Biosynthesis of secondary metabolites
eli01120  Microbial metabolism in diverse environments
eli01130  Biosynthesis of antibiotics
eli01200  Carbon metabolism
Module
eli_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eli_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eli00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ELI_13520
   00640 Propanoate metabolism
    ELI_13520
   00660 C5-Branched dibasic acid metabolism
    ELI_13520
Enzymes [BR:eli01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ELI_13520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ABC64796
UniProt: Q2N695
Position
complement(2723878..2725077)
Genome map
AA seq 399 aa AA seqDB search
MNLHEYQAKELLAKYGIGIPAGHAALTVEEAVAGAKQLPGPLYVVKAQIHAGGRGKGKFK
ELGPDAKGGVRLAKSIEDVEASAREMLGNTLVTVQTGEEGKQVNRLYVTDGVDIASEYYL
SMVVDRASGRVGMIVSTEGGMDIEEVAHSTPEKITTITIDPAQGFMPHHGRAVAFALKLS
GDLNKQAQKLAKQLYTAFMDLDCEMLEINPLVETEDGQLLVLDTKMSIDGNALYRHKDVE
EMRDETEEDPAEVEASEYDLAYIKLDGNIGCMVNGAGLAMATMDIIKLNGAFPANFLDVG
GGATTEKVTAAFKIILKDPAVEGILVNIFGGIMRCDTIAEGIVVAAKEVELDVPLVVRLE
GTNVEKGKDILANSGLPIVPADDLGDAARKIVAEVKQAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacctccacgaataccaggccaaggaactgcttgcgaaatacggcatcggcatcccc
gccggccacgccgcattgaccgtcgaagaggcggtcgcgggtgccaagcagctccccggg
ccgctctatgtcgtgaaggcgcagatccatgccggcggccgcggcaagggcaaattcaag
gaactcggccccgatgcgaagggcggcgtgcgcttggccaagagcatcgaggacgtcgaa
gccagcgcgcgggagatgctgggcaacacgctggtgaccgtgcagacgggtgaagagggc
aagcaggtcaaccgcctctacgtcaccgacggtgtcgacatcgccagcgaatactacctc
tcgatggtcgtcgatcgggcttcgggtcgcgtcggcatgatagtgtccaccgaaggcggg
atggatatcgaggaagtcgcccattcgacgccggagaagatcaccaccatcaccatcgac
ccggcgcagggcttcatgccgcaccacggccgcgcggtggctttcgcactcaagctgtcg
ggtgatctcaacaagcaggcgcagaagctcgccaagcagctctacaccgccttcatggac
ctcgattgcgaaatgctcgagatcaacccgctcgtggagaccgaagacggccagcttctc
gtgctcgacaccaagatgagcatcgacggcaacgcgctctatcgccacaaggacgtggaa
gagatgcgcgacgagaccgaggaagacccggccgaagtcgaagccagcgaatacgatctc
gcctacatcaagctcgacggcaatatcggctgcatggtcaacggcgcaggcctcgccatg
gcgacgatggacatcatcaaattgaacggcgcgttccctgccaacttcctcgacgtcggc
ggcggggcgacgaccgagaaggtcactgcggccttcaagatcatcctcaaggacccggcg
gtcgaaggcatcctcgtcaacatcttcggcggcatcatgcgttgcgacacgatcgccgag
ggcattgtagtagcggccaaggaagtcgaattggacgtgccgttggtggtccgcctcgag
ggcaccaatgtcgagaagggcaaggacatcctcgccaattcgggcctgccgatcgttccg
gcggacgatctgggcgacgcagcgcgcaagatcgtcgccgaagtgaagcaggcggcgtag

DBGET integrated database retrieval system