KEGG   Entomoplasma luminosum: ELUMI_v1c00030Help
Entry
ELUMI_v1c00030    CDS       T05209                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
elj  Entomoplasma luminosum
Pathway
elj00430  Taurine and hypotaurine metabolism
elj00620  Pyruvate metabolism
elj00640  Propanoate metabolism
elj00680  Methane metabolism
elj01100  Metabolic pathways
elj01120  Microbial metabolism in diverse environments
elj01200  Carbon metabolism
Module
elj_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:elj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ELUMI_v1c00030 (ackA)
   00640 Propanoate metabolism
    ELUMI_v1c00030 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    ELUMI_v1c00030 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    ELUMI_v1c00030 (ackA)
Enzymes [BR:elj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     ELUMI_v1c00030 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase LacAB_rpiB
Motif
Other DBs
NCBI-ProteinID: ATZ16732
UniProt: A0A2K8NSA4
Position
complement(5413..6597)
Genome map
AA seq 394 aa AA seqDB search
MILVVNPGSSSIKFQLFETQNTTPISILEGLAERIGIDGNLVMKFQGQKYEWKINMPDHL
AAVGEINNRMLELQVIKNKADITGIGFRTVHGGDKFIQPTIINEEVKKVIEANFKLAPLH
NPPGLVAINAFEKEFKIPMVAVFDTSFHQTLAPLNYLYPVPYNWYTDHKVRKYGFHGISY
EYITTHMSQVLKIDQNKLNLIICHLGNGASMAAIKNGKSLDTSMGFTPLAGLMMGTRSGD
IDPSIVQYMVKETGMDVFQITDALNKQSGLFGMSGLSDMRDVTDAVRAGNEQVTLTWKKY
CQVVDRYLVDYANQLEGKIDAIVFTAGVGENSKSTRAEIIANAKLLELELDENANHAKYT
DYNLISTPKSKYPIYCVRTNEELMICNHTLKLIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtagtaaatcctggttcaagttcaattaaattccagttgtttgaaacccaa
aacacgacaccaatttcgattttagaaggattggctgaaaggattgggattgatggaaat
ttagtgatgaaattccaaggccaaaaatatgaatgaaaaatcaatatgccagatcattta
gcagcagttggagaaattaacaatcgcatgcttgaattacaagtcatcaaaaacaaagca
gatatcaccggaattggttttagaactgtgcatggtggagataaatttattcaaccaacc
attattaatgaagaagtgaaaaaagtaattgaagcgaattttaaattagcaccattacat
aacccaccaggtttagttgcgatcaacgcttttgaaaaagaatttaaaattccgatggta
gcagtttttgacacatcatttcatcaaactttagctccacttaattatttatatcctgtt
ccatacaattgatatactgatcacaaagttcgaaaatacggttttcatggaatcagttat
gaatacattacaacccatatgagccaagttttaaaaattgaccaaaacaaattaaactta
attatttgtcatttaggaaatggagctagtatggcagctatcaaaaatggtaaatccctt
gatacatcaatgggatttactccgttagctggattgatgatgggaaccagatctggagat
atcgatccttcgattgttcaatacatggttaaagaaactgggatggatgttttccaaatc
accgatgctctaaataaacaatctggtttatttgggatgagtgggttgagtgacatgcgt
gatgtcactgatgctgttagagccggaaatgaacaagtaactttaacatgaaaaaaatac
tgtcaagttgttgatcgttatcttgtggattacgctaaccaacttgaaggtaaaattgat
gcgattgtatttacagctggagttggagaaaattcaaaatcaacaagagcagaaattatt
gccaacgccaaattactggaattagaacttgatgaaaatgccaatcatgctaaatatact
gattacaatttaatttcaactccgaaatcaaaatacccaatttattgtgttcgtaccaac
gaagaattaatgatttgtaatcacacattaaaattgattaaatag

DBGET integrated database retrieval system