KEGG   Enhydra lutris kenyoni (northern sea otter): 111148048
Entry
111148048         CDS       T05871                                 

Definition
(RefSeq) ankyrin repeat domain-containing protein 53 isoform X1
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Brite
KEGG Orthology (KO) [BR:elk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:elk03036]
    111148048
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    111148048
SSDB
Motif
Pfam: Ank_2 Ank Ank_5 Ank_4 Ank_3
Other DBs
NCBI-GeneID: 111148048
NCBI-ProteinID: XP_022360126
UniProt: A0A2Y9JHS7
Position
Unknown
AA seq 562 aa
MLPGEKVYKVSWSGPESQSPRWAGDEGAGLRGLSGGAGSRAGGSPWAARGARRTGRGSGF
ASPGVLGDGGFLLALPTSEPRSGLGAQGQPSLSRTRLRRAAGPDPDSTFSLTSPLPTHTN
PDDEGKQSVAGNYYELFAAALGNLEWLRFCLSRGRDKIPADDKGFTAIHFAAQSGKLTCL
QALVEEYKFPVDLPTKNGQTPLHLVIDGDNKSMTLPCIHYLLEQGAALNTQTCSGCTPLH
LAACKGLLSCVKVLVQNGANVHARDALGCKPIDYCKIWNHRDCARYLKDAMWKRDKKDFA
REMGKLKRLKDQLAFMEQDYLTEYQKEHQVLREADCKKWLHRKQLLRGQSQTCNTKQAPY
APQPASTVSRTPKRQGPQKSFYPSPEARLWQTSVPKLQPSGIPTPTYMQPMVRRPKSWNV
SNNPARSPTTQIGYPQGIRLGVHPDPSPEHDFRSFLEVRSDRYGGVQLRTVAGSLVAPVP
QLPFEVVVQELHPSVRPHRLKVPQGFGPVSMSTVPQKRHFSDDNFWTDTLAMNLRETFDE
AFLATVRAHQGLPTLPSPKNLP
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgctgccgggggagaaagtctacaaggtcagctggagtggcccggagtcccagtcgccc
aggtgggccggggatgagggggccgggctgcggggactctctggaggggcagggtcccga
gcgggcgggagcccttgggcggcgcgaggagcccggagaacggggcgggggtccgggttc
gcctccccaggggtgctcggcgatggtggcttcctccttgcgctgccgaccagcgagccc
cggtccggtctcggtgctcaaggacagccctcactctcacgcacgcgcctccgcagggcc
gccggcccagacccagactccactttctcgctcaccagccctctcccaacccacactaac
cctgacgatgaggggaaacagagtgtcgctgggaactactacgagctgttcgcggccgca
ctgggcaacttggaatggttgcgcttctgtctgagtcggggtcgtgacaaaattccggca
gatgacaagggcttcactgccatccactttgcagcccagagtggcaagctcacgtgcctg
caggccttagtagaggagtacaagtttcccgtggacctgcccaccaagaatggccagaca
ccgctgcacctggtcatcgacggggacaacaagagcatgaccctcccctgcattcactat
ctacttgagcaaggggcggccctcaacacgcagacatgcagtggctgcacacccctccac
ctggcagcctgcaagggcctgctgagctgtgtgaaggtgctggtgcagaatggtgccaat
gtccatgcccgggacgccctgggctgcaagcccatcgactactgcaaaatatggaaccac
cgcgactgtgcccggtacttgaaggatgccatgtggaaacgggacaagaaggacttcgct
cgtgagatggggaaactgaagaggctcaaggaccagttggccttcatggaacaggactac
ctgactgagtatcagaaagagcaccaagttctgagagaagctgactgcaagaagtggctc
catcgcaagcagctgctccgaggccagtcccagacttgcaacaccaagcaagcaccttat
gctccccagccggcgagcacggtctccaggacccccaagcgccaggggccccagaagagc
ttctacccctccccggaggcacgcctgtggcagacctcagtgcccaagctgcagccttcg
gggatacccacccccacctacatgcagcccatggtcaggcggcccaagtcgtggaatgtt
agcaacaaccctgccagatcgcccaccacccagatcggctacccacagggcatccgcctg
ggtgtgcatccggaccccagcccggagcatgacttccgcagcttcctcgaggtgaggtct
gaccggtacggcggtgtacagctgcgtacagtggccggcagcctcgtagcacctgtgccc
cagctgcctttcgaggtggtagtccaagagctgcatccttcagtgcggccacacaggttg
aaagtgccccagggcttcggccctgtcagcatgagcactgtgccccagaagcggcacttt
agtgacgacaacttttggaccgacactctggccatgaacctgcgtgagacctttgatgaa
gccttcctggccactgtgcgagcccatcaagggctccccactctgccctcccccaagaat
ctcccataa

DBGET integrated database retrieval system