KEGG   Enhydra lutris kenyoni (northern sea otter): 111148453
Entry
111148453         CDS       T05871                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Brite
KEGG Orthology (KO) [BR:elk00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:elk01002]
    111148453
Enzymes [BR:elk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     111148453
Peptidases and inhibitors [BR:elk01002]
 Metallo peptidases
  Family M1
   111148453
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 111148453
NCBI-ProteinID: XP_022360712
UniProt: A0A2Y9JI79
Position
Unknown
AA seq 942 aa
MLSLFIRWPLVTMPFLPSSLLILLTVSTPSWCQSSDTTSPKAGNGTPFPWEKMRLPEHIT
PVHYDLLIHANLTTLSFEGTTEIEITASQPTSTIILHSHLLQISKATLKKRVGERLSVEP
LRVLEYPPHEQIALLAPEPLAVGLLYTVVIDYSGHLSEHLNGFYKSTYRTKEGEVRVLAS
THFEPTAARMAFPCFDEPAFKANFSVKIRREPRHLAISNMPLVKSVTVAEGLLEDHFDVT
VKMSTYLVAFIISDFKSISKMTKSGVKVSVYAAPDKIHQADYALDTAVTLLEFYEDYFSI
PYPLPKQDLAAIPDFESGAMENWGLTTYRESILLFDAETSLASDKLGITMMVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVEDYFFGKCFNVMEVDALNSSHPV
STPVVKPAQIREMFDEVSYEKGACILNMLRDYISADAFKSGIVQYLQKYSYKNTRNEDLW
NSMASICPTDGSERMDGFCSRGPHSSSTSHWRQEGLDVKTMMNTWTLQKGFPLITVTVRG
RNVHMRQEHYTKGPEDAAETGYLWHVPLTFITSKSNSVQRFLLKTKTDVLILPEEVEWIK
LNVGMNGYYIVHYEDDGWDSLTGLLKGAHTTISSNDRASLINNAFQLVSNGKLSIEKALD
LALYLKRETEIMPVFQGLNELIPMYKLMEKRDMKEVENQFKAFLIRLLRDLIDKQTWTDE
GSVSQRMLRTELLLLACVRKYQPCVQRAEAYFRDWKEADGNLSLPSDVTLAVFAVGVQNP
EGWDFLYRKYQSSLSTSEKNKIEFALSISQDKNKLQWLLDESFKGDVIKIQEFPYILGAV
GTNPVGYPLAWQFLRENWDKLIEKFELGSNSLTHMVIRMTSQFSTRARLEEVEEFFSSLK
EKGSQLRCVQQTIETIGENIRWMDKNFEKIRVWLQSQELELL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atgttatctctgttcatcagatggccactggtaaccatgccatttctaccgtcctcactg
ttgattctcttaactgtgtcaactccttcgtggtgtcagagcagtgacactacatctcca
aaagctggcaatgggactccattcccttgggagaaaatgcgacttcctgagcacatcacc
ccagtgcattacgatctcctgatccatgcaaatctcaccactctgtctttcgagggaacc
acggaaatagaaatcacagccagccagcctacgagtaccatcatcctgcatagtcacctc
ctgcaaatatctaaggccaccctcaagaagagagtcggagagaggctgtctgtagaaccc
ttgagagtcctggagtacccgcctcacgagcaaatcgcacttctggctcctgagcctctg
gctgttggactcctgtacacagttgtcattgactactctggccatctttctgagcatttg
aatggattttataaaagcacctacaggaccaaggaaggggaagtgagagtactggcatca
acacactttgaacccaccgcagccagaatggcctttccctgctttgatgaacctgccttc
aaagcgaatttttcagtcaagatcagaagggagccaagacacctcgccatctccaatatg
ccactggttaaatctgtgactgttgctgaaggactcctagaagaccattttgatgtcact
gtgaagatgagcacctacctggtggccttcattatttcagattttaagtctattagcaag
atgaccaagagtggagtcaaggtttccgtatatgctgcgccagacaagatacatcaggca
gattatgccctggacactgcagtgactcttctggaattttacgaggactatttcagcatt
ccgtatcccttacccaaacaagatcttgctgctattcctgactttgagagtggtgctatg
gagaactggggactgaccacatacagagaatcgattctcttgtttgacgctgagacgtct
ttggcatccgataagcttggcattacgatgatggtgtcgcatgaacttgcccaccagtgg
tttgggaacctcgtcaccatggaatggtggaatgatctttggttaaatgaaggatttgcc
aagtttatggagtttgtgtcggtcagcgtgactcatcctgaactgaaagttgaagattat
ttcttcggcaagtgttttaatgtgatggaggttgacgcgttaaattcctcacatcctgtg
tcaacacctgtggtgaaacctgctcagattcgggagatgtttgatgaagtttcttatgaa
aagggagcttgtattctgaatatgctaagggattatatcagtgctgacgcatttaaaagt
ggtattgtacagtacctccagaagtatagctacaaaaacacaagaaatgaggacctgtgg
aatagtatggcaagtatttgccctacagatggctcagaaaggatggatggcttttgctcc
aggggtcctcattcatcttcaacctcacactggagacaggaaggccttgatgtaaaaacc
atgatgaacacgtggacgctgcagaagggctttcccctgataaccgtcacggtgagaggg
aggaacgtgcacatgaggcaggagcactacaccaaaggacctgaggacgccgcagaaact
gggtacctgtggcatgttccactgacattcatcactagcaaatcaaactcagtccaaaga
tttttgctgaagacaaaaacagatgtgctcatcctcccagaagaggtagaatggatcaaa
ttgaatgttggaatgaacggctattacattgtgcattatgaagatgatggatgggattct
ttgactggccttttaaaaggagcacacacaacgatcagcagcaacgatcgggccagtctc
atcaacaatgcgtttcagctcgtcagcaatggaaagctatcaattgaaaaagccttggac
ttagccctgtacttgaaacgtgaaactgaaattatgccggtcttccaaggtttgaacgag
ctgatacctatgtataagttgatggagaaaagagatatgaaggaagtggaaaatcagttc
aaggcctttctcatcaggctgctgagggacctcattgataagcagacgtggacagatgag
ggctccgtctcgcagcgaatgctgcggactgagctgctcctacttgcctgtgtgcgcaag
tatcagccctgcgtgcagagggcggaagcctatttcagagactggaaggaagccgatgga
aatctgagcctgcccagtgatgtgaccttggcagtgtttgctgtgggggtccagaaccct
gaaggatgggattttctttatagaaaatatcagtcatctttgtctacttctgagaaaaat
aaaatagaatttgccctcagtattagccaagataagaacaagcttcagtggctactagat
gaaagttttaagggagatgtaataaaaattcaagagtttccatatattcttggagctgtc
ggcacgaacccggtgggatatccattggcctggcagtttctgagggaaaattgggataaa
ctgatagaaaagtttgaacttggctcaaattccctaacccatatggtcatccgaatgaca
agccagttctccacaagagcacggcttgaagaggtagaagaattcttcagctctttaaaa
gaaaagggttctcagctacgttgtgtccaacaaacaattgaaaccattggggaaaacatc
cgttggatggacaagaattttgagaagatcagggtgtggctacaaagccaggagctcgaa
ctgctctaa

DBGET integrated database retrieval system