KEGG   Enhydra lutris kenyoni (northern sea otter): 111153452
Entry
111153452         CDS       T05871                                 

Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Brite
KEGG Orthology (KO) [BR:elk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111153452
Transcription factors [BR:elk03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    111153452
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_4 PAS_9
Other DBs
NCBI-GeneID: 111153452
NCBI-ProteinID: XP_022368184
UniProt: A0A2Y9K9A9
Position
Unknown
AA seq 721 aa
MIPPGECLYAGRKRRKPVQKQRPATGSEKSNPSKRHRDRLNAELDHLASLLPLPPDIVSK
LDKLSVLRLSVSYLRVKSFFQAVQKGPRQPAASVPAPEDRSPSARSAVLEGRLLLESLDG
FALVVSAEGMIFYASATIVDYLGFHQTDVMHQNVYDYIHVDDRQDFCRQLHWAMDPPRAA
CGQPPPADTGQDAVLERLLRAQEGGADAPVDFSAFLTRCFVCRVRCLLDSTSGFLTMQFQ
GKLKFLFGQKRKAPSGTVLPPRLSLFCVVVPVLLPPVAETKVKNVSLRARHRVDVSAATD
AKARAAAHRCELELHGQPSHFTGRSNGENIPVLRTQADAGRWARVPARAPCLCLRSGPDL
VSDPEGAAGDRGGDEHGRVPSGCSGAKGRREMHAYSCCFEAPGPVKPLSWMPGKHGQDGG
TKLKPGPSESVPFSGHATSRGSCVPCPGVQGPIHASGVTAFRNSPSCHPGGHSPSAYVSC
TSRALQDGDQGQVRPPPSCPFPQGSLDSGLPQPRGQRLTVAGYSIEDTKLRGGPVPSGAS
CNPILSLDVPIKMESDSGSEDAADGYSMSPSQVWLGASGMAKRQTVTFPTRMHLKTELEA
RPHLYAPHLGRSLLEAPLSGRGPLRAGRELVPSRPTHCSCLGHAHSLPEPDPPPHFYAQG
HQAPALGCDCRAAGTVPIVKREPLDSPPWASHSQGGVPGMFPKSAVATLMPPKAPEGVFL
P
NT seq 2166 nt   +upstreamnt  +downstreamnt
atgatcccgccgggggagtgcctatacgccggccgcaagagacggaagccggttcagaaa
cagaggccggccacggggtccgagaagtcaaacccttccaagcggcaccgggaccgcctc
aacgccgagctggaccatctggccagcctgctgccgctccctcccgacatcgtgtcgaag
cttgacaagctctctgtcctgcgcctcagcgtcagctaccttcgcgtgaagagcttcttc
caagctgtccagaagggcccgcggcagccggcggccagtgtccctgcacccgaagaccgc
agtccaagtgcgaggtccgccgtgctggagggaaggctgctgctggagtctctcgatggc
tttgccctggtcgtgagtgcagaaggcatgatattttatgcttcagcaacaatcgtggac
tatctgggcttccaccagacggacgtgatgcaccagaacgtctacgactacatccacgtg
gacgaccgccaggacttctgccgccagctgcactgggccatggaccccccccgggcggcg
tgcgggcagccgccgcccgcggacacagggcaggacgccgtcctggagaggctgctgcgc
gcgcaggagggaggcgcggacgcgcccgtggacttctcggccttcctgacgcgctgcttc
gtgtgccgcgtgcgctgcctgctggacagcacctcgggcttcctgacaatgcagtttcaa
ggaaaactaaaattcctgttcggacagaagaggaaagcgccgtcagggacagtcctgccc
cctcggctctcgctgttctgcgttgtggtgcctgtcctcctacctcctgtggcagagacg
aaagtgaagaacgtgtccctgagggcgaggcacagggtggacgtctcggccgcgacggac
gcaaaggcgagagcggccgcacatcggtgtgagctagaactccacgggcagcccagccac
ttcacagggagaagcaatggagaaaacattccagtgctcaggacacaagcggacgcggga
cgctgggcccgggttccagccagggcaccatgcctgtgcctcagaagtggccccgacctc
gtttctgaccccgagggggctgcaggggacaggggaggagacgagcacgggagggtgccc
agtggctgctcaggagccaagggacggagggaaatgcacgcctacagctgctgcttcgag
gcgcctggacccgtgaagcctctgagctggatgccagggaagcacggccaggacgggggc
accaagctgaagccagggcccagcgagagtgtcccgttctctgggcacgccacgtccaga
ggctcctgtgtgccctgcccaggcgttcagggccccatccacgccagcggcgtgactgct
tttagaaattcacccagctgccacccaggaggccattctcccagtgcctacgtcagctgc
accagcagagctctgcaggacggcgatcagggccaggtgcgccctccgcccagctgcccc
ttcccccaggggagcctggacagtgggctccctcagcccagagggcagcgtctcacagtg
gcaggctattccattgaggacaccaagcttcgaggtgggcctgtaccctcgggagcctcg
tgcaaccccatcttgtcgcttgatgtgcccatcaaaatggagagtgactctgggtctgag
gacgcagcagacggctactccatgtccccaagccaggtgtggctgggagccagtggcatg
gccaagagacagacggtcactttccctaccaggatgcacctgaaaacagagctggaagcc
aggccccacctgtacgctccgcacctggggcgcagcttgctggaggctcccctgagcggc
aggggtcccctcagagctgggcgggagctggtcccctcccgccccacacactgctcctgc
ctggggcacgcgcacagccttcctgagccagatcctcccccccacttctatgcacaggga
caccaggcccctgcactgggctgtgactgcagagcggcgggaaccgtgcccatcgtcaaa
cgagaacccctggactcaccaccatgggccagtcacagccagggcggggtgcctggaatg
ttccccaaaagcgctgtggcaacgctgatgcctcccaaggcccccgagggtgttttcctg
ccgtag

DBGET integrated database retrieval system