KEGG   Enhydra lutris kenyoni (northern sea otter): 111155836
Entry
111155836         CDS       T05871                                 

Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Brite
KEGG Orthology (KO) [BR:elk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:elk03021]
    111155836
Transcription machinery [BR:elk03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     111155836
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 111155836
NCBI-ProteinID: XP_022371962
UniProt: A0A2Y9KDT7
Position
Unknown
AA seq 1229 aa
MDSFDLALLQEWDLESLCVYEPDRNVLRRKERERRNQETQQDDGTFNSSYSLFSEPYKTN
KGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGVPKPGVPQAPVNKIDEHFVADSRAQT
QPSSVCSTASSTPAAVPTQQSKRGTMGWQKAGHPPSDGQQRATQQGSLRTLLGDGVGRQQ
PRAKQVCNVEVGLQTQERPPAMAAKHSSSGHCVQNFPPSLASKPSLVQQKPTAYVRPMDG
QDQAPDESPKLKSSTETSVHCTSYRGVPATKPESARAKAKLSKFSIPKQGEESRSGDTNS
CVEEIIREMTWLPPLSAIPAPGKVEPSKFPFPNKDSQLVSSGHNNPKKGDAEPESPDNGT
SNTSMLEDDLKLSSDEEENEQQAAQRTALHALSDSAVVQQANCRASVPSSKGSSSGSSSS
GSSSSSDSESSSGSDSETESSSSESEGSKPPHYSSPEAEPASSNKWQLDKWLNKVNPHKP
PILIQNESHGPESNQYYTPAKEEVQDCGKLPNVCQTSLREKDIKSACKEEQRPRTANKAP
GSKGVKQKSPPAAVAVAVTAAVQPPAVPGAPTESVPAPTRRSAGKKPTRRTERTSAGDST
NCHRPEEPAAADTLGASVVIPPEPTKTRPCGNSRTSHRKELRSSVTCEKRRTRGLSRIVP
KSKEFIETESSSSSSSSDSDLESEQEEYPLSKVQAVAAAAAASSGNDQRLKEAAGSISSG
GGPRAPVGSINARTTSDIAKELEEQFYTLVPFGRNELLSPLKDSDEVRSLWVKIDLTLLS
RIPEHLPQEPGVLNAPAAKDAESTQTSHPSDTPAEKALPKSKRKRKCDNEDDYREVKKAQ
GEKDSSSRLTASANNTLPANHCSMNINSLAIPINKNEKMLRSPISPLSDASKHKYPSEDL
TSSSRSNGSGLFTSASSNKKHKAENQLQSHAGDLTKAAHNNSENILHKSRPQTEPWSPGA
NGHRDCKRQKLVFDDMPRSADYFMQEAKRMKHKADAMVEKFGKALNYAEAALSFIECGNA
MEQGPMESKSPYTMYSETVELIRYAMRLKTHSGPNATPEDKQLAALCYRCLALLYWRMFR
LKRDHAVKYSKALIDYFKNSSKAAQAPSPWGASGKSTGTPSPMSPNPSPTSSVGSQGSLS
NANALSPSTIVSIPQRIHQMAANHVSITNSILHSYDYWEMADNLAKENREFFNDLDLLMG
PVTLHSSMEHLVQYSQQGLHWLRNSTHLS
NT seq 3690 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagccctgctccaggaatgggacctcgagtcgctgtgtgtctat
gaaccagacagaaatgtgttacggaggaaagaacgagaaagaagaaatcaggaaactcag
caagatgatggcacgtttaattcgagttactccctcttcagtgaaccttacaagacgaac
aagggggatgagctctccaaccggatccagaatactttaggcaattacgatgaaatgaaa
gactttttaactgatagatctaatcagagtcatctcgtgggtgttcccaaacctggggtt
cctcaggctcctgtgaacaagattgatgaacattttgttgcagattcaagagcccagacc
cagccctcatctgtctgtagcacagcttcttccacaccagcagctgtccccacgcagcag
agtaagaggggcaccatgggctggcagaaggctgggcacccgccatcagatggccaacaa
agagcaacacaacaaggctctctcaggaccttgcttggagatggtgttggcagacagcag
ccacgagccaaacaagtgtgcaatgtagaggtgggtcttcagacccaggaaaggccacct
gctatggcagccaagcacagcagcagcggacactgtgttcagaactttcctccatccctg
gcttcaaaacccagtctggtccagcagaaacccaccgcatatgtgcggccgatggacggc
caagatcaggctcctgatgagtctccaaaacttaaatcatccacagaaaccagtgtgcac
tgcacgtcatacaggggagtcccagccaccaagccagagtccgccagagccaaggccaag
ctttccaagttcagcatccccaaacaaggagaggagagtagatctggagacacaaacagc
tgtgttgaagaaataattcgggagatgacctggctcccaccactttctgcaattccagca
cctggcaaagtggaaccaagcaaatttccatttccaaataaggactctcagctcgtttcc
tccggacacaataatccaaagaaaggtgatgctgagccagagagtccagacaatggcaca
tcgaatacatcaatgctagaagatgaccttaagctaagtagtgatgaagaggagaatgag
cagcaggcagcccagagaacagctctccacgctctgtctgacagcgccgtggtccagcag
gccaactgcagagcctccgtgccttccagcaagggcagcagcagcggcagcagcagcagc
ggcagcagctcgtccagtgactcagagagcagctctggatctgactcggagaccgagagc
agttccagcgagagtgagggcagcaagcctccccactactccagccccgaggctgaacca
gcgtcttctaacaagtggcagctggataaatggctaaacaaagttaatccccacaagcca
cctattctgatccaaaatgaaagccacgggccagagagcaatcaatactacactccagca
aaagaggaagtgcaggactgtgggaaacttcccaacgtttgccaaaccagcctgagagag
aaggacatcaagagcgcctgcaaggaggagcagaggccaaggacagcgaacaaggcccca
gggagtaaaggagtgaagcagaagtcccctcccgcagccgtggccgtggccgtgactgca
gctgtccagccgcccgccgtgcctggcgcgcctaccgagagcgtgcccgcgcccacccgg
aggtctgcaggaaagaagcccaccaggcgcaccgagaggacctccgctggcgacagcacc
aactgccaccggcctgaggagcccgcagccgcggacacgctgggggcgagcgtggtgatc
cctccagagcccaccaaaaccagaccctgcggcaacagcagaacgagccaccgcaaggag
ctgcgctcctcggtgacctgtgagaagcgccgcacgcgggggctgagcaggatcgtcccc
aaatccaaggagttcatagaaacagagtcgtcatcttcctcctcctcctcggactcggac
ctggagtcagagcaggaggagtaccctctgtccaaagtgcaggccgtggccgctgctgct
gccgcctcctctgggaatgaccagaggctgaaggaagcagctggcagcatcagcagtggc
ggcggcccccgggcccctgtaggctccatcaacgccaggaccaccagtgacattgccaag
gagctggaggagcagttctacacactggtccctttcgggcgcaatgaacttctctccccc
ttaaaggatagtgatgaagtcaggtctctctgggtcaaaattgacctgaccctcctgtcc
agaatcccagaacacctgccccaggagcctggggtcttgaatgcccctgcagccaaggat
gctgagagcacacagacgagccacccatccgacactccagccgaaaaggctttgccaaaa
tccaagaggaaacgcaagtgtgacaatgaagacgactacagggaggtcaagaaggcccag
ggagaaaaagacagctcttcacgactgactgcctctgccaataatactttacctgcaaac
cactgcagcatgaatatcaacagcttggcaataccaataaataaaaatgaaaaaatgctc
cggtcacccatctcacccctttcggatgcatctaaacacaaatatcccagtgaggactta
acttcttccagcagatcaaatggcagtggcttgttcacttctgcctcctccaacaaaaag
cataaggctgagaaccagctgcagtctcacgccggagacctcacgaaggccgctcacaac
aattccgaaaacattctccacaagtcacggccacagacagagccatggtctccaggtgcc
aatggccacagggactgcaagaggcagaaacttgtcttcgatgatatgccacgcagtgca
gattattttatgcaagaagctaaacggatgaagcataaagcagatgcaatggtggaaaag
tttggaaaggctttgaactatgctgaagcagctttgtcatttattgagtgtggaaacgca
atggaacaaggcccgatggaatccaaatctccttatacaatgtattcggaaacagtagag
ctcatcaggtatgctatgagactaaaaacccattcaggcccgaatgcaacaccagaggac
aaacaattggctgcattatgttaccgctgcctggctctcctgtactggcggatgtttcgg
ctcaaaagagaccacgctgtgaagtattcaaaagcacttatcgactatttcaagaattca
tctaaagctgcccaagccccatctccatggggggccagtggaaagagcactggaacccca
tcccctatgtctcccaacccctcccccaccagctctgtgggatctcaggggagcctctcc
aatgccaacgccctgtccccttcaaccatcgtcagcatcccacagcgcatccaccagatg
gcagccaatcacgtcagcatcaccaatagcattctccacagctatgactactgggagatg
gcagacaacctggccaaggagaacagagaattcttcaatgacctggatttgctcatgggg
cctgtcaccctgcacagcagcatggaacatctggtccagtactctcagcagggcctgcac
tggctgcggaacagcacccacctctcatag

DBGET integrated database retrieval system