KEGG   Enhydra lutris kenyoni (northern sea otter): 111157276
Entry
111157276         CDS       T05871                                 

Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04080  Neuroactive ligand-receptor interaction
elk04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111157276
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111157276
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 111157276
NCBI-ProteinID: XP_022374278
UniProt: A0A2Y9KMF0
Position
Unknown
AA seq 77 aa
MNLRRCMQALLLLWLSLTAACGGPLLQPADGKGLEEGNVRHLVQPRGSRNGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgcggcgctgcatgcaggcgctcctgctgctctggctctccctgactgcggcg
tgtggagggcccctgctgcagcctgctgatggcaaggggctggaggagggcaacgtccgc
cacctggtgcagcccagaggctcaaggaatggaccgggtccctggcagggcggtcggagg
aaatttcgccgccagcggccacgcctctcccacaagggccccatgcctttctga

DBGET integrated database retrieval system