KEGG   Enhydra lutris kenyoni (northern sea otter): 111157863
Entry
111157863         CDS       T05871                                 

Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:elk00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111157863
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:elk04040]
    111157863
Ion channels [BR:elk04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   111157863
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 111157863
NCBI-ProteinID: XP_022375268
UniProt: A0A2Y9KQ75
Position
Unknown
AA seq 558 aa
MPIQIFCSVSFSSGEEAPGPLGDVWGPHWQRRDNSESEEEEDEKETEAVTKEAGEGDSPV
DLVAFANSCTLHGASHIFVEGGPGLRQALWAVAFVLALGAFLCQVGDRVAYYLSYPHVTL
LDEVATTELAFPAVTLCNTNAVRLSQLSYPDLLYLAPMLGLDESDDPGVPLAPPGPEAFS
GEPFNLYRFYNRSCHRLEDMLLYCSYCGGPCGPHNFSVVFTRYGKCYTFNSGRDGRPRLK
TMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPG
FQTFVSCQEQRLIYLPPPWGTCKAVTMDSDFFDSYSITACRIDCETRYLVENCNCRMVHM
PGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYL
AKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILTV
LELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTYA
ANILPHHPARGTFEDFTC
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgcccatccagatcttctgctctgtgtccttctcctctggagaggaggccccagggccc
ttgggagatgtttggggtccccactggcagcggcgggacaactcagaatcagaagaggag
gaagacgagaaagaaacggaggcagtgacaaaggaggccggagagggggattcgcccgtg
gatttggtggcctttgccaacagctgcaccctgcacggcgccagccacatcttcgtggag
gggggtccggggctgaggcaggccctgtgggcagtggcctttgtcctcgctctgggcgcc
ttcttgtgccaggtgggggaccgcgtcgcctattacctcagctacccgcacgtgactctg
ctagacgaggtggccaccacggagctggccttcccggccgtcaccctctgcaacactaat
gccgtgcgcctgtcccagctcagctaccctgacttgctctacctggcccccatgctgggg
ctggacgaaagtgatgaccctggggtgccccttgccccaccggggcccgaggccttctcc
ggggagcctttcaacctgtaccgcttctataatcgctcctgccaccggctggaggacatg
ctgctgtattgctcctactgtggggggccctgtggccctcacaacttctcagtggtcttc
acgaggtatggcaagtgctacacattcaactcgggccgagacgggcgtccgcggctgaag
accatgaagggtgggactggcaatgggctggagatcatgctggacatccagcaggatgag
tacctgcctgtatggggagagactgatgagacgtccttcgaagcgggcatcaaagtgcag
atccacagtcaggatgaacctcccttcatcgaccagctgggctttggtgtggccccaggg
ttccagacctttgtgtcctgccaggagcagcggctcatctacctgcccccgccctggggc
acctgcaaagctgtcaccatggactcggatttcttcgactcctacagcattactgcctgc
cgcatcgactgtgagacacgctacctggtggagaactgtaactgtcgcatggtgcacatg
ccaggggatgccccatactgcaccccagaacaatacaaggagtgcgcggatcctgctctg
gacttcctggtggagaaggaccaggagtactgtgtatgtgaaatgccctgcaacctaacc
cgctatggcaaggagctgtccatggtcaagatccccagcaaagcatcagccaagtacctc
gccaagaagttcaacaagtctgagcagtacataggggagaacatcctggtgctggacatt
ttctttgaagtcctcaactatgagactattgagcagaagaaggcctatgaaattgcaggg
ctcctgggtgacatcgggggccagatggggctgttcattggggccagcatcctcacggta
ctggagctctttgactacgcctatgaggtcattaagcacaagctgtgcagaagaggaaag
tgccagaaggaggccaaaaggagcagcgccgacaagggcgtggcccttagcctggatgac
gtcaaaagacataacccgtgtgagagcctccggggccaccctgctgggatgacctacgct
gccaacatcctacctcaccatccggcccgaggcacttttgaggactttacctgctga

DBGET integrated database retrieval system