KEGG   Enhydra lutris kenyoni (northern sea otter): 111160231
Entry
111160231         CDS       T05871                                 

Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    111160231
Enzymes [BR:elk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     111160231
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 111160231
NCBI-ProteinID: XP_022378849
UniProt: A0A2Y9L5I6
Position
Unknown
AA seq 318 aa
MWLPLLLGVLLWAALWLLRDRQSLPASDAFVFITGCDSGFGRLLALRLDQRGFRVLASCL
TPSGAEDLQRVASSRLHTTLLDVTDPQSVQRAAKWVETQVGEAGLFGLVNNAGVAGIIGP
TPWLTQNDFHRVLNVNTLGPIGVTLALLPLLQQARGRVVNITSVLGRLAANGGGYCVSKF
GLEAFSDCLRRDVAHFGVRVSIVEPGFFRTPVTNLKSLEDTLQECWARLPSATQARYGEA
FLTKYLEVQQRVMNLICDPDLTKVSRCLEHALTARYPRTRYSPGWDAKLLWLPASYLPAS
LVDAVLTWLLPKPAQAVC
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcccctgctgctgggagtcttgctctgggcagcgctgtggttgctcagggac
cggcagagcctacccgccagcgacgcctttgtcttcatcactggctgtgactcaggcttc
ggccggcttctggccctgagactggaccagagaggcttccgagtcctggccagctgcctg
accccctcaggggcagaggacctacagcgggtggcctcctcccgcctccacaccaccctg
ctggatgtcacggatccccagagtgtccagcgggcagccaagtgggtggaaacacaggtt
ggagaagcagggctttttggtctagtgaataacgctggtgtggccgggatcattgggccc
accccatggctcacacagaacgatttccatcgggtgctcaacgtgaatacactgggtccc
atcggtgtcacccttgccctactgcccctgctgcagcaggcccggggccgggtggtcaac
atcaccagtgttctgggtcgcctggcagccaatggcgggggctactgtgtttccaagttt
ggcctggaggccttctctgactgtctgaggcgggatgtggctcattttggggtccgagtc
tccatcgtggagcctggcttcttccgaacccctgtgacaaatctcaagagtttggaggat
acactgcaggagtgctgggcacggctaccttctgccacacaggcccgctatggggaggcc
ttcctcaccaaatacttggaagtacagcagcgcgtcatgaacctgatctgtgatccagac
ctgaccaaggtgagcaggtgcctggagcatgccctcactgctcgttaccccagaacccgt
tacagcccaggctgggacgccaagctgctctggctgccagcctcctaccttccagccagc
ctggtggatgctgtgctcacctggctccttcccaagcctgcccaggcagtctgctga

DBGET integrated database retrieval system