KEGG   Escherichia coli W: WFL_00425Help
Entry
WFL_00425         CDS       T02101                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
ell  Escherichia coli W
Pathway
ell00471  D-Glutamine and D-glutamate metabolism
ell00550  Peptidoglycan biosynthesis
ell01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ell00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    WFL_00425 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    WFL_00425 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ell01011]
    WFL_00425 (murD)
Enzymes [BR:ell01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     WFL_00425 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:ell01011]
 Precursor biosynthesis
  Amino acid ligase
   WFL_00425 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AFH09754
UniProt: E0IYU1
Structure
PDB: 

Position
98762..100078
Genome map
AA seq 438 aa AA seqDB search
MADYQGKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRMTPPGLDKLPEAVERHTGSLND
EWLMAADLIVASPGIALAHPSLSAAADAGIEIVGDIELFCREAQAPIVAITGSNGKSTVT
TLVGEMAKAAGVNVGVGGNIGLPALMLLDAECELYVLELSSFQLETTSSLQAVAATILNV
TEDHMDRYPFGLQQYRAAKLRIYENAKVCVVNADDALTMPIRGADERCVSFGVNMGDYHL
NHQQGETWLRVKGEKVLNVKEMKLSGQHNYTNALAALALADAAGLPRASSLKALTTFTGL
PHRFEVVLEHNGVRWINDSKATNVGSTEAALNGLQVDGTLHLLLGGDGKSADFSPLARYL
NGDNVRLYCFGRDGAQLAALRPEVAEQTETMEQAMRLLAPRVQPGDMVLLSPACASLDQF
KNFEQRGNEFARLAKELG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggctgattatcagggtaaaaatgtcgtcattatcggcctgggcctcaccgggctttcc
tgcgtggactttttcctcgctcgcggtgtgacgccgcgcgttatggatacgcgtatgaca
ccgcctggcctggataaattacccgaagccgtagaacgccacacgggcagtctgaatgat
gaatggctgatggcggcagatctgattgtcgccagtcccggtattgcactggcgcatcca
tccttaagcgctgccgctgatgccggaatcgaaatcgttggcgatatcgagctgttctgt
cgcgaagcacaagcaccgattgtggcgattaccggttctaacggcaaaagcacggtcacc
acgctagtgggtgaaatggctaaagcggcgggggttaacgttggtgtgggtggcaatatt
ggcctgccagcgttgatgctgcttgatgctgagtgcgaactgtacgtgctggaactgtcg
agcttccagctggaaaccacttccagcttacaggcggtggcggcgaccattctgaacgtg
actgaagatcatatggaccgctatccgtttggtttgcagcaataccgtgcggcaaaattg
cgtatttacgaaaatgcgaaagtttgtgtcgtcaatgctgatgatgccttaacaatgccg
attcgcggtgctgatgaacgctgcgtcagctttggcgtcaacatgggtgactatcacctg
aatcatcagcagggagaaacctggctgcgagtgaaaggcgagaaagtgctgaacgtgaaa
gagatgaaactttccgggcagcataactacaccaatgcgctggcagcactggcactggca
gacgcagctggtttgccgcgcgccagcagcctgaaagcgttaaccaccttcaccggtctg
ccgcatcgctttgaagtggtgctggagcacaatggcgtacgctggattaacgattcgaaa
gccactaacgtcggcagtacggaagcggcgttgaatggcttgcaggtagacggcacgctg
catttgttgctgggcggcgatggtaaatcggcggacttcagtccactggcgcgctatctg
aatggcgacaacgtgcgtttgtactgttttggtcgtgacggtgcgcagctggcggcgcta
cgcccggaagtggcagaacaaaccgaaactatggaacaggcgatgcgcttgctggctccg
cgtgttcagccgggcgatatggttctgctctccccggcctgtgccagccttgatcagttc
aagaactttgaacaacgaggcaatgagtttgcccgtctggcgaaggagttaggttga

DBGET integrated database retrieval system