KEGG   Escherichia coli W: WFL_01075
Entry
WFL_01075         CDS       T02101                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
ell  Escherichia coli W
Brite
KEGG Orthology (KO) [BR:ell00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ell02044]
    WFL_01075
Secretion system [BR:ell02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   WFL_01075
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: AFH09884
UniProt: E0J662
Position
complement(251550..252881)
AA seq 443 aa
MATTRNKVMWQEGMLMRPHHFQQQQRYNDYLDNQRFRAMNNLSWGFTELTLNNELLAQGK
IMIDSASGTLPDGTVFSIPDQDALPDPLHPQHFPDERSRNIYLALPVASDVRNEISDGRR
IGRYRLNYADVRDLHSEEGDTRTLTLGQLTPRIMSGAEDMSAYITLPLCRISDRHADGSL
TLDDDFIPSCQNIQVSKKLRVYLKEVQGAIGGRASDLANRIGSPAQSGIADVAEFMMLQL
LNRNQTRFTHRARRSQLHPEDFYLDLAGLLGELMTFTEPSRLPCPLDVYDHHDLTKTFKT
LLPEVKRALHTVLSPRAVNLPLHLRDGIWQADIHDTELLQSATFVLAVAANMPVDQIQRQ
FIQQSKISSPEKIRNMVSVQIPGIPLRALMVAPRQLPYHSGFSYFELDKSGQAWTEMAAA
GAVALHVSGSFPDLNMQLWAIRG
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggcaaccacccgcaacaaggtgatgtggcaggaagggatgctgatgcgtccacaccat
ttccagcagcagcagcgttacaacgactacctggataaccagcgtttccgggccatgaat
aatttatcctggggatttaccgaactcactctcaacaatgaactgctggcacagggtaag
atcatgattgacagcgcgtcaggcacactgcccgacggcaccgtcttttctatccccgac
caggacgcactgcccgatccgctgcacccgcaacattttccggacgagagaagccgcaat
atctacctcgctctgccggtcgccagtgatgtgagaaatgaaatcagcgacgggcggcga
atcgggcgttaccggctgaattatgccgatgtccgggatttgcattcagaagaaggtgac
acgcgaacactgacgctgggacaactgacgccgcgcattatgagcggtgcagaagatatg
agcgcctatattacgctcccgctttgccgtatcagtgatcgccatgccgacggctccctg
acgctggatgacgattttatcccctcctgccagaatattcaggtcagtaagaaactgcgt
gtttatctcaaagaggtacagggggccattggcggacgggcaagcgatctggcaaaccgc
attggctctccggcgcagagcggcatcgcggatgtggcggaatttatgatgttgcagtta
cttaaccgtaaccagacccggtttacccatcgcgctcgtcgatcccagctccacccggaa
gatttctaccttgatcttgccgggttgctgggtgaactgatgacctttaccgagccgtcg
cgcctgccctgcccgcttgatgtgtatgatcatcatgacctgaccaaaacatttaaaacg
ctgttaccggaagtcaaacgggcgctgcataccgtactgtcgccaagagccgttaatctg
ccgctgcatctgcgtgacggtatctggcaggccgatatccatgacacagaactgctgcaa
tctgccacctttgtgctggctgtggcggcaaacatgccggtcgatcagatccagcgccag
tttatccagcagtcgaaaatttcctcgccggaaaaaatccgcaatatggtcagtgtgcag
atacccggcattccattgcgtgccctgatggtggctccccgccagcttccttaccattcc
gggttcagctatttcgaactcgacaagagcggacaggcctggacagaaatggctgccgcc
ggggccgttgcactgcatgtatccggcagtttcccggatctgaacatgcaactgtgggcg
ataagagggtaa

DBGET integrated database retrieval system