KEGG   Escherichia coli W: WFL_03925Help
Entry
WFL_03925         CDS       T02101                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ell  Escherichia coli W
Pathway
ell00010  Glycolysis / Gluconeogenesis
ell00260  Glycine, serine and threonine metabolism
ell00680  Methane metabolism
ell01100  Metabolic pathways
ell01110  Biosynthesis of secondary metabolites
ell01120  Microbial metabolism in diverse environments
ell01130  Biosynthesis of antibiotics
ell01200  Carbon metabolism
ell01230  Biosynthesis of amino acids
Module
ell_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ell_M00002  Glycolysis, core module involving three-carbon compounds
ell_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ell00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WFL_03925 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    WFL_03925 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    WFL_03925 (gpmA)
Enzymes [BR:ell01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     WFL_03925 (gpmA)
Membrane trafficking [BR:ell04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    WFL_03925 (gpmA)
Exosome [BR:ell04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   WFL_03925 (gpmA)
  Exosomal proteins of melanoma cells
   WFL_03925 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: AFH10451
UniProt: E0J4G7
Structure
PDB: 

Position
complement(854817..855569)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacctctgtgctg
aaacgcgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcggaaactgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgca
gtgactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccgcgttac
gcgaaactgagcgaaaaagaactgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaactattctgccgcgtatgaagagcggtgagcgcgtgatc
atcgctgcacacggtaactctttacgtgcgctggtgaaatatcttgataacatgagcgaa
gaagagattcttgagcttaatatcccgactggcgtgccgctggtgtatgagttcgacgag
aatttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcagcgaaagca
gcggcggttgcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system