KEGG   Escherichia coli W: WFL_09485Help
Entry
WFL_09485         CDS       T02101                                 

Gene name
selD
Definition
(GenBank) selenophosphate synthetase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
ell  Escherichia coli W
Pathway
ell00450  Selenocompound metabolism
ell01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ell00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    WFL_09485 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ell03016]
    WFL_09485 (selD)
Enzymes [BR:ell01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     WFL_09485 (selD)
Transfer RNA biogenesis [BR:ell03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    WFL_09485 (selD)
 Prokaryotic Type
    WFL_09485 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AFH11556
UniProt: E0IXD1
Structure
PDB: 

Position
complement(1989700..1990743)
Genome map
AA seq 347 aa AA seqDB search
MSENSIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNG
TSVISTTDFFMPIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAILGWPINKLSPEIARE
VTEGGRYACRQAGIALAGGHSIDAPEPIFGLAVTGIVPTERVKKNSTAQAGCKLFLTKPL
GIGVLTTAEKKSLLKPEHQGLATEVMCRMNIAGASFANIEGVKAMTDVTGFGLLGHLSEM
CQGAGVQARVDYDAIPKLPGVEEYIKLGAVPGGTERNFASYGHLMGEMPREVRDLLCDPQ
TSGGLLLAVMPEAENEVKATAAEFGIELTAIGELVPARGGRAMVEIR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaactcgattcgtttgacccaatacagccacggagctggttgcggctgtaaa
atttccccaaaagtgttggaaaccatcctgcacagtgagcaggcgaagtttgttgatccg
aatttgcttgtgggtaatgagacccgcgacgatgcggcggtgtacgatctgggcaatggc
accagcgttatcagtaccaccgacttctttatgccgatcgttgataatcctttcgatttt
ggccgcattgcggcgactaacgccatcagcgatatcttcgcgatggggggcaaaccgatt
atggcgattgcgatcctcggctggccgattaacaaactttccccggaaattgcccgcgaa
gtaaccgaaggtggacgctatgcatgccgtcaggcgggtattgcgctggcgggcggtcac
tccatcgatgcgccggagccgatttttggtctggcggtaacggggatcgtaccgaccgag
cgggtgaagaaaaacagtaccgcacaagccggatgcaaactgttcctgacgaaaccgctg
gggatcggcgttcttaccacggctgagaaaaaatcactgctgaaaccagaacatcaggga
ctggcgacagaagtgatgtgccggatgaatatcgcaggcgcgtcctttgccaacatcgaa
ggcgtaaaagcgatgaccgacgttacgggctttggtctgctgggccatttgagcgaaatg
tgtcagggcgcaggtgtgcaggcgcgcgttgactatgacgcgatcccgaaattgccgggg
gttgaagagtacattaagttgggcgcagtgccaggcggcaccgaacgtaactttgccagc
tacggtcatctgatgggtgaaatgccgcgtgaagtgcgcgatctgctgtgcgatccgcaa
acttctggcggtttgctgctggcggtcatgccggaagcagaaaatgaggttaaagctaca
gccgccgagtttggcattgaactgacggcgattggcgaactggtgccagcgcgcggcggt
cgtgccatggttgagatccgttaa

DBGET integrated database retrieval system