KEGG   Escherichia coli W: WFL_14655Help
Entry
WFL_14655         CDS       T02101                                 

Gene name
truC
Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
ell  Escherichia coli W
Brite
KEGG Orthology (KO) [BR:ell00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ell03016]
    WFL_14655 (truC)
Enzymes [BR:ell01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     WFL_14655 (truC)
Transfer RNA biogenesis [BR:ell03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    WFL_14655 (truC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AFH12582
UniProt: E0J214
Position
complement(3072818..3073600)
Genome map
AA seq 260 aa AA seqDB search
MLEILYQDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRLLAQQFEQHQIQKRYHAIVRGWLMEEAVLDYPLVEELDKIADKFAREDK
GSQPAVTHYRGLATVEMPVATGRYPTTRYGLVELEPKTGRKHQLRRHLAHLRHPIIGDSK
HGDLRQNRSGAEHFGLQRLMLHASQLSLTHPFTGEPLTIHAGLDDTWMQALSQFGWRGLL
PENERVEFSAPSGQDGEISS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaatactctatcaggatgaatggctggttgcggtaaataaaccctccggctgg
ctggttcaccgcagctggctggatcgcgacgagaaagtagtggtcatgcaaaccgtgcgt
gatcagattggccagcacgtttttaccgctcatcgtctggaccgacccacttctggtgtg
ttgttgatgggattatccagcgaggccggacggctgctggcacaacagtttgaacagcac
caaatccagaaacgttaccatgcgattgtgcgcggctggttgatggaagaagcagttctg
gattatccactggtggaagaactggacaaaatcgctgataaatttgcccgcgaagataaa
ggctcgcagccagcagtgacgcattatcgcggtctggcgaccgtagaaatgccggtagcg
accggacgttacccgaccacgcgctacggcctggtggaactggagccgaaaaccggacgc
aaacatcagcttcgccgacatcttgcccatttgcgtcatccgattattggcgatagcaaa
catggcgatttacgccagaatcgcagcggtgctgagcattttggcctccagcggttaatg
ctacatgccagtcagttgtcattgacgcatccttttactggcgagccgctgactattcac
gcgggcctggacgacacctggatgcaggcgttatcacaatttggctggcgcggtctgctt
cctgaaaatgaaagggttgagttcagtgcgccatcgggtcaggatggagagataagttcc
taa

DBGET integrated database retrieval system