KEGG   Escherichia coli W: WFL_14775
Entry
WFL_14775         CDS       T02101                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ell  Escherichia coli W
Brite
KEGG Orthology (KO) [BR:ell00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ell02044]
    WFL_14775
Secretion system [BR:ell02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   WFL_14775
SSDB
Motif
Pfam: T6SS_VipA GerD Imm65
Other DBs
NCBI-ProteinID: AFH12605
Position
3097972..3098472
AA seq 166 aa
MADSFQNEVPAARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSERDKIDINK
NNFNSVMAEFSPAVNLTVEDTLSGSGNEQNIALEFKSLKDFEPEQVAKNIPQLRVLLAMR
NLLRDLKSNLLDNATFRRELENILKDPTLSSELRDELAKIAPQENV
NT seq 501 nt   +upstreamnt  +downstreamnt
atggccgacagtttccagaatgaagttcccgccgctcgtgtaaatatcaagcttgacctg
catacaggcaatgctaaaaagaaagttgaactccccctcaagcttcttgctgttggcgat
tacagtaacggaaaagagcaacgtccgctgtccgaacgggacaagattgatatcaataaa
aacaacttcaacagtgtcatggctgagttttcgcctgcggttaatttaacagtagaagac
acactaagcggaagcggtaatgagcaaaatatcgcgcttgaatttaaaagcctgaaagat
tttgaacccgaacaggtagcaaaaaatatcccacagcttcgtgtattactcgctatgcgc
aatttattacgtgacctgaaatccaatctgttagataacgcaacgtttcgacgtgaactg
gaaaatatcctgaaagacccgacgctcagttcagaactgcgtgatgaactggcgaaaatt
gcgccgcaggagaacgtttaa

DBGET integrated database retrieval system