KEGG   Escherichia coli W: WFL_15240
Entry
WFL_15240         CDS       T02101                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase subunit XdhC
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ell  Escherichia coli W
Pathway
ell00230  Purine metabolism
ell01100  Metabolic pathways
ell01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ell00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    WFL_15240 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AFH12697
Position
3197118..3197597
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVQDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgttggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttcaggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system