KEGG   Escherichia coli W: WFL_18940Help
Entry
WFL_18940         CDS       T02101                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
ell  Escherichia coli W
Pathway
ell00051  Fructose and mannose metabolism
ell01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ell00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    WFL_18940 (mtlD)
Enzymes [BR:ell01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     WFL_18940 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N AfaD
Motif
Other DBs
NCBI-ProteinID: AFH13430
UniProt: E0J7D4
Position
3973895..3975043
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGETEQVDTV
SGVNAVSSIGDDVVDLIAQVDLVTTAVGPVVLERIAPAIAKGLVKRKEQGNESPLNIIAC
ENMVRGTTQLKGHVMNALPEDAKAWVEEHVGFVDSAVDRIVPPSASATNDPLEVTVETFS
EWIVDKTQFKGALPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DEKIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYSLPHKNLIQGIAGAMHFRSEDDPQAQELAALIADKGPQAALAQ
ISGLDANSEVVSEAVTAYKAMQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatatcggtcgtggctttatcggtaaactgctg
gcagacgcgggtatccaactgacgtttgccgatgtcaatcaggtggtacttgatgccctg
aatgcccgtcatagctatcaggttcatgtggttggtgaaaccgagcaggtagataccgtt
tccggcgtcaatgctgtcagcagcattggtgatgatgtcgttgatctgattgctcaggtc
gatttagtcactaccgccgttggcccggttgtgctggaacgtattgctccggctatcgcc
aaagggctggtgaaacgcaaagaacaaggtaatgaatccccgctgaacatcatcgcctgt
gaaaacatggtacgcggtaccacgcagctgaaaggccatgtgatgaacgccctgccggaa
gacgccaaagcgtgggtagaagaacacgttggctttgtcgattccgccgttgaccgcatc
gtaccgccttcggcttcggcaactaacgatccgctggaagtgacggtagaaactttcagc
gaatggattgtcgataaaacgcagttcaaaggcgcactgccgaacatcccaggcatggag
ttaaccgacaacctgatggcatttgtcgaacgtaaactcttcaccctgaacacgggtcat
gctataaccgcgtacctcggaaaactggccggtcatcagaccattcgtgacgctattctc
gacgagaaaatccgcgcggtggtaaaaggtgcgatggaagaaagtggtgcggtactgatc
aagcgctacggctttgacgcagacaaacatgcggcgtacatccagaaaatcctcggtcgt
tttgagaacccgtatctgaaagatgatgtagagcgcgtaggccgtcagccgctgcgtaaa
ctgagtgctggcgaccgtctgatcaagccactgctcggtacgctggaatacagccttccg
cacaagaatctgattcaggggattgctggtgcaatgcacttccgcagtgaagatgatccg
caggctcaggaactggcagcactgatcgctgacaaaggtccgcaggcggcgctggcacag
atttccggtcttgatgccaacagcgaggttgtatccgaggcggtaaccgcttataaagca
atgcaataa

DBGET integrated database retrieval system