KEGG   Escherichia coli W: WFL_20985Help
Entry
WFL_20985         CDS       T02101                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
ell  Escherichia coli W
Pathway
ell00561  Glycerolipid metabolism
ell00640  Propanoate metabolism
ell01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ell00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    WFL_20985 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    WFL_20985 (gldA)
Enzymes [BR:ell01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     WFL_20985 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AFH13839
UniProt: E0J6A3
Structure
PDB: 

Position
complement(4399372..4400475)
Genome map
AA seq 367 aa AA seqDB search
MDRIIQSPGKYIQGADVINRLGEYLKPLAERWLVVGDKFVLGFAQSTVEKSFKDAGLVVE
IAPFGGECSQNEIDRLRGIAETAQCGAILGIGGGKTLDTAKALAHFMGVPVAIAPTIAST
DAPCSALSVIYTDEGEFDRYLLLPNNPNMVIVDTKIVAGAPARLLAAGIGDALATWFEAR
ACSRSGATTMAGGKCTQAALALAELCYNTLLEEGEKAMLAAEQHVVTPALERVIEANTYL
SGVGFESGGLAAAHAVHNGLTAIPDAHHYYHGEKVAFGTLTQLVLENAPVEEIETVAALS
HAVGLPITLAQLDIKEDVPAKMRIVAEAACAEGETIHNMPGGATPDQVYAALLVADQYGQ
RFLQEWE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcattattcaatcaccgggtaaatacatccagggcgctgatgtgattaatcgt
ctgggcgaatacctgaagccgctggcagaacgctggttagtggtgggtgacaaatttgtt
ttaggttttgctcaatccactgtcgagaaaagctttaaagatgctggactggtagtagaa
attgcgccgtttggcggtgaatgttcgcaaaatgagatcgaccgtctgcgtggcatcgcg
gagactgcgcagtgtggcgcaattctcggtatcggtggcggaaaaaccctcgatactgcc
aaagcactggcacatttcatgggtgttccggtagcgatcgcaccgactatcgcctctacc
gatgcaccgtgcagcgcattgtctgttatctacaccgatgagggtgagtttgaccgctat
ctgctgttgccaaataacccgaatatggtcattgtcgacaccaaaatcgtcgcgggcgca
cctgcacgtctgttagcagcgggtatcggcgatgcgctggcaacctggtttgaagcgcgt
gcttgctctcgtagcggcgcgaccaccatggcgggcggcaagtgcacccaggcggcgctg
gcactggctgaactgtgctacaacaccctgctggaagaaggcgaaaaagcgatgcttgcc
gccgaacagcatgtagtaaccccggcgctggagcgcgtgattgaagcgaacacctatttg
agcggcgttggttttgaaagcggcgggctggcggcggctcacgcggtgcataacggcctg
accgctatcccggacgcgcatcactattatcacggtgaaaaagtggcatttggtacgctg
acgcagctggttctggaaaacgcaccggttgaggaaatcgaaaccgtagctgcacttagc
catgcggtaggtttgccaataactctcgctcaactggatattaaagaagatgtcccggcg
aaaatgcgaattgtggcagaagcggcatgtgcagaaggtgaaaccattcacaacatgcct
ggcggcgcgacgccagatcaggtttacgccgctctgctggtagccgaccagtacggtcag
cgtttcctgcaagagtgggaataa

DBGET integrated database retrieval system