KEGG   Eubacterium limosum: ELI_0278Help
Entry
ELI_0278          CDS       T01336                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase
Organism
elm  Eubacterium limosum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_7 Fer4_21 Fer4_2 Fer4_10 Fer4_9 Fer4_16 Fer4_17 Fer4_4 Fer4_18 Fer4_22 Fer4_8 Fer4_15 Fer4_13
Motif
Other DBs
NCBI-ProteinID: ADO35297
UniProt: E3GI12
Position
260799..261101
Genome map
AA seq 100 aa AA seqDB search
MNRPKLSPPQPSGTIEQLPMGPSTRSGHLIDVSSGMRTFRPVIDAEKCVNCLRCFLVCPD
GTIDKSGDILEIDYDYCKGCGVCAKACKVEAITMIKEADA
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgacctaaattatcgccgccacagccgtcaggcacgatcgagcagctgcccatg
gggccgtcgacacgttcgggccatctgattgacgtgagctcagggatgcggacattccgg
ccggtgatcgacgcggaaaaatgtgttaactgcctgcgctgctttttagtgtgtcccgat
ggcaccattgataaatcaggagatatccttgaaatagattatgattactgtaaaggctgc
ggcgtatgtgcgaaagcatgtaaggttgaggccattacgatgattaaggaggcagacgca
tga

DBGET integrated database retrieval system