KEGG   Eubacterium limosum: ELI_1112Help
Entry
ELI_1112          CDS       T01336                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
elm  Eubacterium limosum
Pathway
elm00220  Arginine biosynthesis
elm00250  Alanine, aspartate and glutamate metabolism
elm00290  Valine, leucine and isoleucine biosynthesis
elm01100  Metabolic pathways
elm01110  Biosynthesis of secondary metabolites
elm01130  Biosynthesis of antibiotics
elm01210  2-Oxocarboxylic acid metabolism
elm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ELI_1112
   00290 Valine, leucine and isoleucine biosynthesis
    ELI_1112
   00220 Arginine biosynthesis
    ELI_1112
Enzymes [BR:elm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     ELI_1112
    2.6.1.66  valine---pyruvate transaminase
     ELI_1112
Amino acid related enzymes [BR:elm01007]
 Aminotransferase (transaminase)
  Class I
   ELI_1112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ADO36100
UniProt: E3GKR2
Position
1061149..1062366
Genome map
AA seq 405 aa AA seqDB search
MRTFKKSKKLDNVCYDIRGPVVEEADRMTAEGIDIIMLNTGNPPTFNLNAPDEVIRDIRY
NLRSSEAYCHSKGIFPARKAIVQYYQTKGLMDLNEEDVYIGNGSSELVSFCMQALVDDGD
EILIPAPDYPLWTACATLAGGRAVHYICDEESNWYPDLEDIRKKITPNTKGIVVINPNNP
TGAVYPREILEGIVKIAVENELIIFSDEIYDQIIYDEIEHVPMGTLTDETLVVTLNGLSK
SHRVPGFRVGWMVFSGNREMARDYIEGINLLATMRLCANVPAQYAIQTSLGGYQSIDDLV
RPGGRLYEQRNIVYKRLNEIPGISCVKPDGALYCFPKIDIKRFNITDDVQFALDFLKRER
VLLVQGTGFNWAEPDHFRVVFLPAPTQLEETMDRLQRFMGGYIQG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagaacttttaaaaaatccaaaaagctggacaacgtctgttatgatatccgcggaccg
gtcgtagaggaagcagacaggatgacggcggaggggattgacatcatcatgctcaatact
ggaaatccgccgaccttcaacctgaacgctccggacgaggttatccgtgatattcgctat
aacctcagaagctctgaggcttattgccactccaaggggattttcccggcacgaaaagcc
attgtgcagtattatcagacaaagggacttatggacctgaatgaggaggatgtgtatatc
ggaaacggctccagtgagctggtctctttctgtatgcaggcactggtggacgacggcgat
gagattttaatcccggcgccggattatccgctctggaccgcctgcgccactctggcaggg
ggcagggctgtccactatatctgtgacgaggagtccaactggtatccggatctcgaggat
attcgaaagaagattacgcccaacaccaagggaattgtcgttatcaaccccaacaacccc
acgggggctgtttatccgagggaaatccttgagggaattgtcaagattgcggttgaaaat
gagctgatcattttttccgatgagatttatgaccagatcatttacgatgaaatcgagcat
gtgcctatgggaacccttactgatgaaaccctggtggtcaccctcaatgggctgtcaaaa
tcccaccgtgttccgggcttcagagttggatggatggttttttcaggaaacagggaaatg
gccagagactatatcgagggtatcaatcttctggcaaccatgcgtctgtgtgccaatgtt
ccggcccagtacgctatccagacctccctcggcggatatcagagtatcgacgacctggtg
cgtccggggggacgtctttacgagcagcgcaacattgtttacaagcggctcaacgagatc
ccgggtatcagctgtgtcaagcctgacggcgcgctgtactgtttcccgaagattgacatc
aaacgcttcaacatcacagacgacgttcagtttgccctggatttcctcaaaagggaacgc
gtgttgctggtacagggcacaggctttaactgggccgagcccgaccatttcagagtggtt
tttctgccagcgcccacacagcttgaagaaaccatggaccgccttcagcgcttcatgggc
ggttatatacaaggataa

DBGET integrated database retrieval system