KEGG   Eubacterium limosum: ELI_1124Help
Entry
ELI_1124          CDS       T01336                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
elm  Eubacterium limosum
Pathway
elm00010  Glycolysis / Gluconeogenesis
elm00020  Citrate cycle (TCA cycle)
elm00620  Pyruvate metabolism
elm01100  Metabolic pathways
elm01110  Biosynthesis of secondary metabolites
elm01120  Microbial metabolism in diverse environments
elm01130  Biosynthesis of antibiotics
elm01200  Carbon metabolism
Module
elm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ELI_1124
   00020 Citrate cycle (TCA cycle)
    ELI_1124
   00620 Pyruvate metabolism
    ELI_1124
Enzymes [BR:elm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ELI_1124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 DUF3182 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ADO36112
UniProt: E3GKS4
Position
1072391..1074268
Genome map
AA seq 625 aa AA seqDB search
MAADIILPKLGMDMQSGTIMTWYKNEGDTVKKGEPLFELMTDKVNIEVEAEDNGVLLKRY
YETGVELPVFTVIGCIGEAGEQVPEHQTVSLRGNMQSPGHLTDEDRAALKAMRSSTREGF
SSAGKTIRATPSARRLAAEHKIDLANVAGSGPKGRIQVEDIEALLEVSKKVEKTEVPQQK
VFTEPEEKKIEASSVPEETNELADEPESIVAEETEEAFTAEPNPGMTGALDMTLEDLVAG
MGSLEAELGSEAHEEDVMEGAAQKAETEAEEGPHAISASPLAEKIAAVENIDIHSIPEGS
GPDGRIMKEDVLKAMAEGSIRHESVIEEVEVQERAPEEEETTEEPILAEPEPKPEKQKEQ
SEPDNRDEEESIVVTGPEPTTPVSEEAKGAADKPPVNGRLEAMPSKRRIIADRMVKSNLE
NAVITLTTEVDMTEVKDLRKKISKKVEKETGYRCTYTDFLLVSVSRALMEHPYINSSLCE
DGVVLHDFVNLGMAVGMDDGLIVPVIRDAHAASFSEMVEKRSELLKLVKAKKLTGDHFKD
STFTVTNLGMYGILEFTAIINQPNSAILSVGEVVDRVRIFKGEPTPRSIMKISLNLDHRV
ADGMAGAKFLQTVKSYMENPALLLF
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagatattattttaccaaagctaggaatggacatgcagtccggaaccataatg
acatggtataaaaacgagggagacaccgtcaaaaaaggtgaaccgctgtttgagctcatg
accgataaagtcaatatcgaggttgaggccgaggataatggtgtccttctgaaacgctac
tatgaaacaggcgtggaactaccggtatttacagtcatcggctgtatcggtgaggctgga
gaacaggtgccggagcatcagacggtttcgctgcgcggcaatatgcagagcccgggccac
ctcacagatgaggaccgcgcagcgctgaaggccatgcgcagctctacccgcgagggattt
tcaagcgcgggcaaaaccatacgcgccacaccgtccgccagacgtttggcggcagagcat
aagattgatctggcaaacgtagctggcagcggccctaaagggcgtattcaggtagaggat
atcgaggcattgctggaagtatccaaaaaagtagagaaaaccgaggtgcctcagcaaaaa
gtctttactgaaccagaggaaaaaaagattgaggcatcaagcgttccagaggaaaccaat
gagttggctgacgaaccggaaagcattgtggctgaagaaaccgaagaagcctttaccgca
gagccgaatccgggaatgaccggagcccttgatatgacccttgaggacctggtagctggg
atgggcagccttgaagccgagctgggcagcgaagcccatgaggaggatgtcatggagggt
gctgctcaaaaggcggaaacagaggcagaagaagggccacatgcaatcagtgcgtcaccg
ctggccgaaaaaatagcggcggtcgaaaatattgacattcacagtattcccgagggcagc
ggtccggacggacgcatcatgaaggaggatgtcctgaaagccatggccgaaggatcaatc
cgccatgaaagcgtgattgaggaggttgaggttcaggagagagcacctgaggaagaggaa
accaccgaagaacccatcctggcagaaccggagccgaagcctgaaaaacagaaagaacag
tcagagcccgacaatagagatgaagaagagagcattgtcgtcacaggccctgagccaacc
accccggtgtctgaggaagcaaaaggagcagctgataaaccgccggtaaacggcagactt
gaagccatgccgtcaaaacgcagaattattgcggaccgcatggtaaagagcaatcttgaa
aacgcagtgatcaccctgacaacagaggtagatatgaccgaggttaaggacctgcgcaag
aaaatcagcaaaaaagttgagaaggaaacaggctatcgctgtacctatacggatttcctg
ctggtttccgtttcaagagccttaatggagcatccctatatcaacagcagtctgtgtgag
gacggcgttgtgctgcatgattttgtaaatctgggcatggctgtgggaatggatgatggc
ctgatcgtccctgttatccgcgacgcccatgccgcaagtttttccgaaatggtcgaaaaa
cgcagcgagctgctcaagcttgtcaaggcgaaaaaactgacaggcgaccattttaaggac
agcacttttacagtaaccaatctgggcatgtatggtatcctggaattcacagctattatc
aaccagcccaacagcgcgattctgagcgtgggcgaggtggtagacagggttcgtatcttc
aaaggcgagccgactccgagatctataatgaagatcagtctgaatctggatcaccgcgtg
gcagacggcatggcaggagccaaattcctccagactgtcaagagctatatggaaaacccg
gccctgctgttattttga

DBGET integrated database retrieval system