KEGG   Eubacterium limosum: ELI_2163Help
Entry
ELI_2163          CDS       T01336                                 

Definition
(GenBank) hypothetical protein
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
elm  Eubacterium limosum
Pathway
elm00625  Chloroalkane and chloroalkene degradation
elm01100  Metabolic pathways
elm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ELI_2163
   00361 Chlorocyclohexane and chlorobenzene degradation
    ELI_2163
Enzymes [BR:elm01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     ELI_2163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like Hydrolase HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ADO37146
UniProt: E3GMT3
Position
complement(2019933..2020622)
Genome map
AA seq 229 aa AA seqDB search
MKKYTTLLFDADGTLMDFKKSEAQALDQTFRKYGIHPTREILDLYADINHGLWKDFENGL
IDKDTLVTSRFQLLFLELGLDIDGMAFEADYQPALGRGAFLIDGAYDLCRVLKKDFRLYI
VTNGVSSTQYSRLSATGLDALMEDIFVSEDAGAQKPQKDFFDYIAARIPGYDPSEALVVG
DSLTSDIQGGINAGIDTCWYNPGREKNLLDIHPDYEIYTLEELPALLER
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatacacgacgcttctctttgacgccgacggcactctgatggattttaaaaag
tccgaggcccaggccctggaccagaccttcagaaaatacggtattcacccgacaagggag
attctggatctttacgcagacattaaccacggcctctggaaagattttgagaacgggctc
atcgacaaggacacactggtcaccagccgtttccagcttttgtttctggagcttggactg
gatattgacggaatggcttttgaggcggattatcagccagccctgggacggggcgctttt
ctcattgatggcgcctatgacctctgcagggttttaaagaaggatttcaggctttatatt
gtcactaacggcgtttcaagcactcagtacagccgtctttcagccacagggcttgatgcg
ctcatggaggacatctttgtctctgaggacgctggcgctcaaaagccccagaaggacttt
tttgactatatcgcggcccgtattccaggctatgatcccagcgaggcgctggtggtcggt
gactccttaacctctgacattcagggcggtatcaatgccggcattgatacctgctggtac
aaccctggcagggagaagaatcttcttgatatccaccctgattatgaaatatacaccctt
gaggagcttccggcccttctggagcgctga

DBGET integrated database retrieval system