KEGG   Eubacterium limosum: ELI_3470Help
Entry
ELI_3470          CDS       T01336                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
elm  Eubacterium limosum
Pathway
elm00561  Glycerolipid metabolism
elm00640  Propanoate metabolism
elm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ELI_3470
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    ELI_3470
Enzymes [BR:elm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     ELI_3470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase PFK
Motif
Other DBs
NCBI-ProteinID: ADO38429
UniProt: E3GFU5
Position
complement(3231577..3232671)
Genome map
AA seq 364 aa AA seqDB search
MAQILISPSKYVQGSGELYRLGEYVSALGKKALCLITDSGLKRNQAVLDKSFEGSGVSVD
YEAFNRECCKKEIDRIGAVCKEKGIDVVIGVGGGKTFDTIKAVGYYHDLPVVIVPTIAST
DAPCSALSVIYTEDGVFESYLFLKQNPNLVLVDTDIIAKSPSRLVVAGMGDALATYFEAR
ACEASNASTCAAGTTTMAAQNLAELCYDTLIEEGFMAKLAADNNCCTKSLEKIIEANTLL
SGIGFESGGLAGAHAIHNGFTVLPECHHMYHGEKVAFGTLVQLVLEDAPVEEIEEVLEFC
LSVGLPVTLKELGVEEVTEEKIRAVAEASTVPDESIHNMPFEVTADSVYAAIMVADSLGK
EYLG
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggctcagattttaatttcaccaagcaaatatgttcaggggtccggtgaattgtaccgt
ttaggagagtatgtttctgcattggggaaaaaggcactctgcctgattacagacagcggc
ctgaaacgaaatcaggctgtgctcgacaaaagctttgagggaagcggcgtatccgttgat
tatgaagcttttaaccgggaatgctgtaagaaagaaatcgaccggatcggcgcggtctgt
aaggaaaaagggattgatgttgtgattggtgtagggggcggaaagacctttgataccatc
aaggccgtaggctattatcacgacctgccggttgtgattgtcccgaccattgcctccacc
gatgcgccgtgcagcgccctgtcggttatttacaccgaagacggcgtgtttgaaagctat
ttgttcttaaaacaaaacccaaatcttgttctggttgataccgacattatcgcgaaatca
ccgtcgcgtctggttgttgccggaatgggcgacgcactggcgacctattttgaagcgcgc
gcctgcgaagccagcaacgcctctacctgcgcggctggcaccacgacaatggcggcacag
aatctggcagagctttgctatgacacgctgattgaagagggctttatggccaagctggca
gctgataataactgctgtaccaagtcgcttgaaaaaattatcgaagccaacacactgctc
agcggtatcgggtttgaaagcggcggcctggcaggcgcccacgcgatccacaacggcttt
accgtattgccggaatgccaccatatgtatcatggcgaaaaagtagcctttggcacactg
gttcagcttgttctggaagacgcgccagtagaagaaatcgaggaagtattggaattctgc
ctgtcagtaggactgccggtaacgctcaaggaacttggcgttgaagaagtcacagaagaa
aagatccgtgcagtggctgaagcttctactgtcccggacgaatccattcacaatatgcca
tttgaggtaaccgctgattctgtttacgcggcgattatggtcgcggacagcctcggtaag
gaatacttgggataa

DBGET integrated database retrieval system