KEGG   Escherichia coli O83 H1 NRG 857C (AIEC): NRG857_01085Help
Entry
NRG857_01085      CDS       T02068                                 

Definition
(RefSeq) hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
eln  Escherichia coli O83:H1 NRG 857C (AIEC)
Brite
KEGG Orthology (KO) [BR:eln00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eln02044]
    NRG857_01085
Secretion system [BR:eln02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NRG857_01085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VasL ImpA_N
Motif
Other DBs
NCBI-GeneID: 12874455
NCBI-ProteinID: YP_006118582
UniProt: A0A0H3EG17
Position
complement(243236..244594)
Genome map
AA seq 452 aa AA seqDB search
MSNNALTQTIVTGSDPRALPEFSAIREEINKANHPSQPELNWKLVESLALSIFKANGVDL
HTATYYTLARTRNQGLAGFCEGAELLAAMIIHEWDKFWPQSGPARTEMLDWFNTRTGNIL
RQQVSFSENDLSLLYRTERALQLICDKLQQVELKRQPRVENLLYFVQNTRKRFEPQPRNR
TDTAAQTMVRTLVYAPEGTASATAETMPPLPDLPEMRVGVRGVADNADKAKQGDTVKGFV
AGAACTAVIASALWWWQAYPMQQQLTQVRDTTQGAATVWLASPVLKEYEQYLQQLLNAPP
LQPLETGMQMMRTADTLWPESLQQQEASRMWSNTLRNRAQASPQMKGWQQARQNLRDFAD
LMMKKETEKQGFTLSYIKTVTWQAERLLNQETPLEYLLTQYQETRTQKQDTQALEKEINE
RLDGLLSRWLLLKNTGQDMATDNRTEPVHPTH
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataacgcactgacacaaactatcgttaccggaagcgatccgcgcgccctgccg
gagttcagcgccatccgcgaagaaattaacaaagctaaccacccgtcacagccggagctg
aactggaaactggtggaatcgctggcgctgtcgatttttaaggccaacggggtggatttg
cataccgccacctactatacgctggcacgtacacgtaatcagggactggcagggttctgt
gaaggcgcggaactgctggctgcgatgatcatccacgaatgggataaattctggccgcag
agtggcccggcgcggactgagatgctggactggttcaacacccgcaccgggaatatcctg
cgccagcaggtttccttttccgaaaatgatctttcgttgctctaccgcacggaacgggct
ttgcagcttatctgcgacaaactccagcaagtggaactgaagcgccagccgcgcgtggaa
aatctgctttattttgtgcagaacacacgcaagcggtttgagccgcagcccagaaaccgt
actgatacggcggcacagaccatggtcagaacgctggtctatgcgcctgaaggcacggct
tccgccacagcggaaaccatgccccccctacccgacctgccggaaatgcgggtgggggtg
cgcggtgtggcagataacgccgacaaagcaaaacagggcgacacggtaaaaggttttgtt
gccggtgccgcctgtactgccgttatcgcatctgcactctggtggtggcaggcgtatccg
atgcagcagcagcttacacaggtcagggataccacacagggagccgccaccgtctggttg
gcctccccggtactgaaagaatatgaacagtacctgcaacagcttctgaatgccccgcca
ctacagccgctggaaaccggaatgcagatgatgcgcaccgcagacaccctctggccggaa
agcctgcaacagcaggaagccagcaggatgtggagcaacacgctgagaaaccgggcgcaa
gccagtccgcagatgaagggctggcaacaagcgcggcagaatttgcgggattttgcagat
ttgatgatgaagaaggagacggagaaacagggtttcaccctatcgtatatcaaaacggtg
acctggcaggccgaacggttactgaatcaagaaacaccactggagtacctgctgacgcag
taccaggagacccgtacacagaagcaggacacacaggcgttggaaaaagagatcaacgaa
cggctggacgggctgttaagccgctggctgctgctgaaaaataccggacaggatatggca
acggataacagaaccgaacctgtccatccaactcattga

DBGET integrated database retrieval system