KEGG   Escherichia coli O83 H1 NRG 857C (AIEC): NRG857_01150
Entry
NRG857_01150      CDS       T02068                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
eln  Escherichia coli O83:H1 NRG 857C (AIEC)
Brite
KEGG Orthology (KO) [BR:eln00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eln02044]
    NRG857_01150
Secretion system [BR:eln02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NRG857_01150
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ADR25661
UniProt: A0A0H3EFC9
Position
complement(261841..262344)
AA seq 167 aa
MSKMNNNGGSVAPKERISVRYTPKVDGVAADIELPLNLLITGNLKGKPDNTPLDERTAIA
INRYNLNAVISEADIEREFVVPAELSDAPNEQMYVNLKVKSMDDLSPDHIASQVPEIKRL
LELREALVALKSPLGNIPAFRAQLQALLENEDTREQLIQELGIAVQK
NT seq 504 nt   +upstreamnt  +downstreamnt
atgagcaaaatgaacaacaatggcggcagtgtcgcgccgaaagaaagaatcagcgttcgg
tatacaccaaaagttgatggggtggctgctgatatcgaattgccgctgaatttattgatc
accggcaatctgaaagggaaaccagataacacgccgttggatgagcgaactgccattgct
atcaaccgctataacctcaacgcagtcatttcagaagctgacattgaacgggagtttgtt
gttccggctgaactcagtgacgctcccaatgagcaaatgtacgtcaacctgaaagtcaaa
tctatggatgacctttctcctgaccatattgccagccaggtaccagaaataaaacgtctg
ctcgaattgcgtgaagccctggtcgcacttaagtctccactaggcaatattccggccttc
cgcgcacaacttcaggcgctactggaaaacgaagacacccgcgagcagctgatccaggaa
ctgggtatcgccgttcagaaataa

DBGET integrated database retrieval system