KEGG   Escherichia coli O83 H1 NRG 857C (AIEC): NRG857_01155Help
Entry
NRG857_01155      CDS       T02068                                 

Definition
(RefSeq) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
eln  Escherichia coli O83:H1 NRG 857C (AIEC)
Pathway
eln03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eln00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    NRG857_01155
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eln02044]
    NRG857_01155
Secretion system [BR:eln02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NRG857_01155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP DCAF15_WD40 SBBP
Motif
Other DBs
NCBI-GeneID: 12874469
NCBI-ProteinID: YP_006118596
UniProt: A0A0H3EF87
Position
263050..263568
Genome map
AA seq 172 aa AA seqDB search
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPS
GQRAHKPFIFTVALNKAVPLLYNALASGEMLPKVELHWWRTSVEGKQEHYFTTRLTDATI
VDMNLHMPHCQDPAQREFTQLLAVSLAYRKVEWEHIKSGTSGADDWRAPLEA
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccccatgttacatttcaattacaggtcagacccaggggaacatcactgccggt
gctttcaccgcagattctgtcggcaatatctacgtgcagggacacgaagatgaaatgctg
gtgcaggagtttctgcataacgttactgttccaaccgatccgcagtctggtcagccttcc
gggcagcgtgctcacaaaccgttcattttcaccgtggcgctgaacaaagccgttccgctg
ctgtacaacgcgctggcctccggtgaaatgctgccgaaagtggagctgcactggtggcgt
acctctgttgaaggcaagcaggagcactacttcaccacacgtcttactgacgcgacgatt
gtggacatgaacctgcatatgccgcactgccaggaccctgcacagcgtgagtttacgcaa
ttgctcgcagtatcactggcctaccgtaaggttgagtgggagcacatcaaatccggtact
tctggtgccgatgactggcgtgcaccgctggaagcataa

DBGET integrated database retrieval system