KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_03060Help
Entry
NRG857_03060      CDS       T02068                                 

Gene name
pdxA
Definition
(RefSeq) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Brite
KEGG Orthology (KO) [BR:eln00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NRG857_03060 (pdxA)
Enzymes [BR:eln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     NRG857_03060 (pdxA)
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     NRG857_03060 (pdxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-GeneID: 12876941
NCBI-ProteinID: YP_006118977
UniProt: A0A0H3EH20
Position
672591..673577
Genome map
AA seq 328 aa AA seqDB search
MNNIIAVTMGDPAGIGPEIIIKSLSEAGLAGAPVVVVGCVRTLRRIMAMNITPQAELRVI
QKVCDAHFAPGVINVMDEPLANPDALTPGVVQAAAGDLAYRCIKRATALALSGEVKAIAT
APLNKEALHLGGHNYPGHTELLAHLTGSKEYAMVLYTDKLKVIHISTHISLRKFLDTLNG
ERVKTVIRVANHFLKRVGIERPRIAVAGVNPHAGEHGLFGTEEIEIIAPAIEAMQAEDID
VTGPCPPDTVFMQCHEGLFDMVVAMYHDQGHIPLKLLGFYDGVNITAGLPFIRTSADHGT
AFDIAWTGKAKSESMAVSIQLAMQISRE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
gtgaataatattattgcggtaacgatgggtgacccggcgggtattggcccggagatcatt
attaaatccctgagcgaagccgggcttgctggtgccccggtggtggtggtgggctgtgtg
cgcacgctgcgacgtattatggcgatgaatatcacgccgcaggcagagttacgcgtcatt
caaaaggtgtgcgacgcccattttgctcccggcgtgattaacgtgatggatgagccgctg
gctaaccccgatgcgctgacacccggagtggtacaggctgcggcaggcgatttagcgtat
cgctgtatcaaacgtgcaacggctctggccttatcaggcgaggtgaaagccatagccact
gcgccgctgaataaagaagcgctgcatcttggcgggcataactatccggggcatacggaa
ttgctggcccatcttaccggcagcaaagagtacgcgatggtgctctataccgataagctc
aaggttatccatatttcgactcacatctcactgcgtaaattcctggataccttgaatggt
gaaagggtcaaaacggttattcgtgttgcgaaccacttcctgaaacgtgttggtattgaa
cgtccgcgtattgccgtggcgggtgtaaatccacatgcaggggaacatggtttattcggc
actgaggaaatcgagattatcgcgcctgcgattgaagcaatgcaggccgaagatattgat
gttactggcccgtgcccgccagataccgtgtttatgcaatgccatgaagggctattcgat
atggtagtggctatgtaccacgatcaggggcatatccctttaaaactgcttggattttat
gatggggtgaatatcaccgccgggttgccatttattcgcacttctgccgaccacggcacc
gcgtttgatattgcctggacaggaaaagccaagtctgagagcatggcagtttccatccag
ttagcaatgcagatttcgcgagaataa

DBGET integrated database retrieval system