KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_03340Help
Entry
NRG857_03340      CDS       T02068                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln00010  Glycolysis / Gluconeogenesis
eln00260  Glycine, serine and threonine metabolism
eln00680  Methane metabolism
eln01100  Metabolic pathways
eln01110  Biosynthesis of secondary metabolites
eln01120  Microbial metabolism in diverse environments
eln01130  Biosynthesis of antibiotics
eln01200  Carbon metabolism
eln01230  Biosynthesis of amino acids
Module
eln_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eln_M00002  Glycolysis, core module involving three-carbon compounds
eln_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NRG857_03340 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    NRG857_03340 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NRG857_03340 (gpmA)
Enzymes [BR:eln01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     NRG857_03340 (gpmA)
Membrane trafficking [BR:eln04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    NRG857_03340 (gpmA)
Exosome [BR:eln04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   NRG857_03340 (gpmA)
  Exosomal proteins of melanoma cells
   NRG857_03340 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-GeneID: 12877083
NCBI-ProteinID: YP_006119033
UniProt: A0A0H3EF20
Structure
PDB: 

Position
complement(735137..735889)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacctctgtgctg
aaacgcgctattcataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcggaaaccgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgcg
gtgactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccgcgttac
gcgaaactgagcgagaaagaactgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaaccattctgccgcgtatgaagagcggtgagcgcgtcatc
atcgccgcacacggtaactcgttacgtgcgctggtgaaatatctcgataacatgagcgaa
gaagagattcttgagctgaatatcccgaccggcgtgccgctggtttatgagtttgacgag
aacttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcggcgaaagca
gcggcggttgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system