KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_07330Help
Entry
NRG857_07330      CDS       T02068                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln00010  Glycolysis / Gluconeogenesis
eln00071  Fatty acid degradation
eln00350  Tyrosine metabolism
eln00625  Chloroalkane and chloroalkene degradation
eln00626  Naphthalene degradation
eln01100  Metabolic pathways
eln01110  Biosynthesis of secondary metabolites
eln01120  Microbial metabolism in diverse environments
eln01130  Biosynthesis of antibiotics
eln01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NRG857_07330
  Lipid metabolism
   00071 Fatty acid degradation
    NRG857_07330
  Amino acid metabolism
   00350 Tyrosine metabolism
    NRG857_07330
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NRG857_07330
   00626 Naphthalene degradation
    NRG857_07330
Enzymes [BR:eln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NRG857_07330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 TrkA_N 2-Hacid_dh_C Methyltransf_31 Phage_holin_2_1
Motif
Other DBs
NCBI-GeneID: 12875087
NCBI-ProteinID: YP_006119824
UniProt: A0A0H3EGU8
Structure
PDB: 

Position
complement(1526977..1527987)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAGYSVDGGMAEE
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLATEMGADLAINSRTEDAARIVQEKAGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcagttgttacgaaggatcatcatgttgacgttacggataaaacactgcgc
tcactgaaacatggcgaagccctgctgaaaatggagtgttgtggtgtatgtcataccgat
cttcatgttaagaatggcgattttggtgacaaaaccggcgtgattctgggacacgaaggt
attggtgtggtggcagaagttggccctggtgttacttcattaaaaccaggcgatcgtgcc
agcgtggcgtggttctatgaaggatgcggtcattgcgaatactgtaacagtggtaacgaa
acgctctgccgttcagttaaaaatgccggatacagcgttgatggcgggatggcggaagag
tgcatcgtggtcgccgattacgcggtaaaagtgccagatggtctggactcggcggcggcc
agcagcattacctgtgcgggggtcactacctacaaagccgttaagctgtcaaaaattcgt
ccaggacagtggattgctatctacggtcttggcggtctgggtaacctcgccctgcaatac
gcgaagaatgtctttaacgccaaagtgatcgccattgatgtcaatgatgaacagttaaaa
ctggcaaccgaaatgggtgcagatttagcgattaactcacgcaccgaagacgccgccaga
attgtgcaggagaaagccggtggcgctcacgcagcggtggtgacagcggtagctaaagct
gcgtttaactcggcggtggatgctgtccgtgcaggtggtcgtgtcgtggctgtcggtctg
ccgccggagtctatgagcctggacatcccacggctggtgctggatggtattgaagtggtc
ggttcgctggtcggcacgcgtcaggatctaaccgaagccttccagtttgccgccgaaggc
aaagtggtgccgaaagtcgccctgcgtccgttagcggacatcaacaccatctttaccgag
atggaagaaggcaaaatccgtggccgtatggtgattgatttccgtcgctaa

DBGET integrated database retrieval system