KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_07800Help
Entry
NRG857_07800      CDS       T02068                                 

Definition
(RefSeq) putative endolysin
  KO
K01185  lysozyme [EC:3.2.1.17]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Brite
Enzymes [BR:eln01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     NRG857_07800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_lysozyme DUF951
Motif
Other DBs
NCBI-GeneID: 12875181
NCBI-ProteinID: YP_006119918
UniProt: A0A0H3EHK9
Position
complement(1620922..1621455)
Genome map
AA seq 177 aa AA seqDB search
MNTKIRYGLSAAVLALIGAGASAPQILDQFLDEKEGNHTMAYRDGSGIWTICRGATVVDG
KTVFPNMKLSKEKCDQVNAIERDKALAWVERNIKVPLTEPQKAGIASFCPYNIGPGKCFP
STFYKRLNAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVIRRDQESALTCWGIEQ
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaaaaatcagatacggcctgtcggctgccgttctggcgctgattggtgctggc
gcatctgctcctcagatacttgaccagtttctggacgaaaaagaaggtaaccacacaatg
gcataccgcgatggttctggcatatggaccatctgtcggggtgccacagtggtggatgga
aaaaccgtttttcccaatatgaaactgtcgaaggaaaaatgcgaccaggtcaacgccatt
gagcgtgataaggcgctggcatgggtggagcgcaatattaaagtaccactgaccgaacca
caaaaagcgggtatcgcgtcattttgtccctataacattggccccggtaagtgtttcccg
tcgacgttttataagcggctgaatgctggtgatcgtaaaggtgcatgcgaagcgattcgc
tggtggattaaggatggcggacgcgattgccgcattcgttcaaataactgttacggtcag
gttattcgtcgtgaccaggagagcgcattaacctgctgggggatagaacagtga

DBGET integrated database retrieval system