KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_11705Help
Entry
NRG857_11705      CDS       T02068                                 

Definition
(RefSeq) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln00130  Ubiquinone and other terpenoid-quinone biosynthesis
eln00627  Aminobenzoate degradation
eln01100  Metabolic pathways
eln01110  Biosynthesis of secondary metabolites
eln01120  Microbial metabolism in diverse environments
eln01220  Degradation of aromatic compounds
Module
eln_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:eln00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    NRG857_11705
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    NRG857_11705
Enzymes [BR:eln01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     NRG857_11705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-GeneID: 12878678
NCBI-ProteinID: YP_006120691
UniProt: A0A0H3EKX8
Position
complement(2444506..2445075)
Genome map
AA seq 189 aa AA seqDB search
MKRLIVGISGASGAIYGVRLLQVLRDVTDIETHLVMSQAARQTLSLETDFSLREVQALAD
VTHDARDIAASISSGSFQTLGMVILPCSIKTLSGIVHSYTDGLLTRAADVVLKERRPLVL
CVRETPLHLGHLRLMTQAAEIGAVIMPPVPAFYHRPQSLDDVINQTVNRVLDQFAVTLPE
DLFARWQGA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgactcattgtaggcatcagcggtgccagcggcgcgatttatggcgtgcgttta
ttacaggttctgcgcgatgtcacagatatcgaaacgcatctggtaatgagccaggcggcg
cgccagaccttatccctcgaaacggatttttccctgcgcgaagtgcaggcgttagctgat
gtgacacacgatgcgcgcgatattgctgccagcatttcttccggttctttccagacgttg
gggatggtgattttaccctgttcaatcaaaaccctgtccggcattgtccatagctatact
gatggcttactgacccgtgcggcagatgtggtgctgaaagagcgtcgcccgttggtgctc
tgcgtgcgtgaaacgccactgcacttaggccatctgcgtttaatgactcaggcggcagaa
atcggtgcggtgattatgcctcccgttccggcgttttatcatcgcccacaatcccttgat
gatgtgataaatcagacggttaatcgtgttcttgaccagtttgcggtaacccttcctgaa
gatctctttgcccgctggcagggcgcataa

DBGET integrated database retrieval system