KEGG   Escherichia coli O83 H1 NRG 857C (AIEC): NRG857_13820
Entry
NRG857_13820      CDS       T02068                                 

Definition
(RefSeq) putative VGR-like protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
eln  Escherichia coli O83:H1 NRG 857C (AIEC)
Pathway
eln03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eln00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    NRG857_13820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eln02044]
    NRG857_13820
Secretion system [BR:eln02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NRG857_13820
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V
Other DBs
NCBI-GeneID: 12877613
NCBI-ProteinID: YP_006121110
UniProt: A0A0H3EN01
Structure
PDB: 
2P5Z

Position
2909799..2912261
AA seq 820 aa
MNVQFFDHAHHKLKIRGLQSPVDVLTFEGREQLSTPFRYDIQFTSSDKAIAPESVLMQDG
AFSLTAPPVQGMPVQTALRTLHGVITGFKHLSSSQDEARYEVRLEPRMALLTRSRQNAIY
QNQTVPQIVEKILRERHQMRGQDFVFNLKSEYPAREQVMQYGEDDLTFVSRLLSEVGIWF
RFATDARLKIEVIEFYDDQSGYERGLTLPLRHPSGLFDGETEAVWGLNTAYSVVEKSVST
RDYNYREATAEMTTGQHDATGGDNTTYGEAYHYADNFLQQGDKEAAESGAFYARIRHERY
LNEQAILKGQSTSSLLMPGLEIKVQGDDAPAVFRKGVLITGVTTSAARDRSYELTFTAIP
YSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKPGYES
LWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKR
NVLRTPANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKEQRGEGFELRTDLWGA
VRAKKGIFISADAQDKAQGQVLEMQPALARLSAALVTMESLAASAQQAQALAADVSRQQT
LLQQKIEQLQQEVLLGSAPKGVALVSGEDMQLSASDNLTLTAGKQLDIGVQKDFTLAAGK
QLSLYSRAGAKLFSSHNDIDIQAQGGNLTTWSTQDTYISSGKKLVVTAQDELTLICGGGY
IKIKSGNVEIGGPGKLLVKNAGIKKAGSGSMQGVMKSFEPESFDENFIISNPASGKPIAN
QKYEIHMPDGSVIAGITDAMGYSSLVASKASDDLKIILKK
NT seq 2463 nt   +upstreamnt  +downstreamnt
atgaacgtacagttcttcgaccacgcacaccacaagctcaaaattcgcggcctgcaaagt
ccggtggatgtgctgacctttgaaggccgcgagcaactgagtaccccgttccgctacgac
attcagtttaccagcagcgataaagccatcgcgccggagtcggtgctgatgcaggatggc
gcattcagcctgacggcaccgccggtacagggaatgccggtacagactgccctgcgcacc
ctgcacggcgtcattaccggctttaaacatctctcatcgtcacaggacgaagcccgttac
gaagtgcgccttgaaccccgtatggcgctgcttacccgcagccgccagaacgccatctac
cagaaccagacggtgccgcaaatcgtcgaaaaaatcctgcgcgagcggcaccagatgcgc
ggtcaggacttcgtgtttaacctcaaaagcgaatacccggcccgcgaacaggtgatgcag
tacggtgaggacgacctgacgtttgtttcacgcctgctgtcagaggtgggtatctggttc
cgctttgccaccgacgcccggttgaaaatcgaagttatcgaattttacgacgaccagagc
ggctacgagcgcgggctgacgctgccgcttcgccatccttctgggctgtttgatggtgaa
acggaagccgtatgggggctgaacaccgcgtacagcgtggtggaaaaaagtgtctccacg
cgggactacaactaccgtgaagccacggcggaaatgaccacaggccagcatgacgccacc
gggggcgataacaccacttacggcgaagcctaccactatgccgacaacttcctgcaacaa
ggcgataaagaggcagcggaaagcggcgcgttttatgcccgtatccgtcacgaacgctac
ctgaatgaacaggccattctcaaaggccagagcaccagttcactgctgatgccggggctg
gagataaaagttcagggcgacgacgcgcctgcggtgttccgcaagggcgtgctgattacc
ggcgtgacgaccagcgcggcgcgtgaccgcagctatgagctgacgttcacggcgataccg
tactcagaacgctacggctaccgtccggcgctaatcccccgcccggtcatggccggaacg
ctcccggcgcgggtcaccagcacggtgaagaacgatatctatgcccatatcgacaaggac
gggcgctaccgagtcaaccttgactttgaccgcgatacgtggaaaccgggttatgaaagc
ctgtgggtacgccagtcgcgcccgtatgcgggagacacctacggcctgcacctgccgctg
ctggcgggaacggaggtcagcatcgcctttgaggaaggcaacccggacaggccgtatatc
gccggggtaaaacacgactcggcgcacaccgaccatgtgaccattcagaactacaagcgc
aacgtgctgcgtaccccggccaacaacaaaatccggctggatgacgagcgcgggaaggag
catatcaaggtcagtaccgaatatggcggcaagagccagctaaacctcggccatcttgtt
gatgccgggaaagaacagcgtggcgaaggctttgaactgcgtaccgatctgtggggcgcg
gtgcgggcgaagaaagggatttttatcagcgctgatgcgcaggataaggcgcagggtcag
gtgctggagatgcagccagctctggctcgcctttctgcagcgttggtgacaatggaatct
ctggctgccagtgcgcaacaggctcaggcactggcggcagatgtgagtcgtcagcagacg
ctgttgcagcaaaaaattgagcagttacagcaggaagtgctactgggtagcgcacctaag
ggcgtggcgcttgtcagcggtgaggatatgcagttgtctgccagcgataatctgactctg
acagcaggtaagcaactggatattggcgtacagaaagactttacgctggcagcaggaaaa
cagctcagcttgtatagccgtgcgggagcaaagctctttagctcacataacgatattgat
attcaggcgcaggggggaaatctgaccacctggtcaacacaggacacctatatatcgagt
ggtaaaaagctggtggtgacagcgcaggatgagttaacactgatttgtggcgggggctat
atcaaaattaaaagtggcaatgtggagattggcggtccgggaaaactattggttaaaaat
gccggtattaagaaagcaggctccggtagtatgcagggcgtgatgaagtcgtttgagcct
gaaagtttcgatgaaaatttcattatttcgaatccagcatcaggtaagccgatagcaaat
caaaaatatgaaatacacatgccagatgggagtgttattgccgggataaccgatgcaatg
gggtattcctctcttgttgcgtcaaaagcatctgatgacctaaaaattattctgaaaaaa
tga

DBGET integrated database retrieval system