KEGG   Escherichia coli O83 H1 NRG 857C (AIEC): NRG857_13865
Entry
NRG857_13865      CDS       T02068                                 

Definition
(RefSeq) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
eln  Escherichia coli O83:H1 NRG 857C (AIEC)
Brite
KEGG Orthology (KO) [BR:eln00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eln02044]
    NRG857_13865
Secretion system [BR:eln02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NRG857_13865
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-GeneID: 12877622
NCBI-ProteinID: YP_006121119
UniProt: A0A0H3EKJ7
Position
2923808..2925568
AA seq 586 aa
MDDLTQRYYEAEMRYLREAGKEFAQAYPDRAAMLNLDKPGARDPYVERLFEGFAFLMGRL
REKLDDDLPELTEGLVSLLWPHYLRTIPSLSVVELSTDHRQMKQSETLKEFQVLSRPIGE
RRTRCVYSATRDITLHPLALPDVSLQYEPDGRSVIRLRFACGPLVGDWSQIDLSRLPLYL
NADSPVACALHRALTLGTQQFWLRLPGQERRVLDAHFSPMGFDDDDRLWPKGESAFSGYQ
LLLEYFTFREKFMFVALNGLENVIWPERITGFEIDVVLAENWPHDLPFNTDNLRLHCVPV
INLFPLEADPLHLSPLENEFLLRPMRIQDGHTEIYSVDNIISSRHTGSQAYVPFSSFRHR
GGMLRHDAPERYYHTRVKRGPSGLHDTWLILGGDAFDTDRMLEDETLSLSLTGTNGQLPR
KALQSTLLDTPVHASQNVLRVRNLCAPTQPCYPPARDRFHWRVLSHLGSNFLSMMDNAEI
LRGTLALYDWTESEMNRRRLEAIVDVQHSLIQRFERGFLLRGVDIQVTLDSNGFAGEGDI
TLFGELLHRFFALYADIHLFTQLTLILQPTGKCLQWTEHHSQRVPG
NT seq 1761 nt   +upstreamnt  +downstreamnt
atggacgacctgacccaacgctactatgaagccgaaatgcgctacctgcgtgaagcgggt
aaagaatttgcgcaggcttaccccgaccgtgctgcgatgcttaatcttgataaacccggc
gcacgcgatccctatgtggagcgcctgttcgagggcttcgcttttttaatgggccgcctg
cgcgaaaagctggacgacgatctgccggaactgactgaagggctggtcagcctgctgtgg
ccccactacctgcgaaccatcccgtcactttccgtggttgaactgtcgacagatcaccgg
cagatgaagcagagcgaaacgctgaaagagtttcaggtgctatcccgtcccatcggcgaa
cgcagaacccgctgcgtctacagtgccacgcgtgatatcacgctgcatccgctggcgttg
ccggacgtgtcattgcaatatgaaccggacggacgctcggttatccgtctgcgctttgcg
tgcggcccgctggttggtgactggtcgcagatcgatttatcccgcctgccgctctatctc
aatgccgacagcccggtagcctgtgcgttgcaccgggctttaacgcttggcacgcagcag
ttctggctgcgtctgccggggcaggaacgccgtgtgctggacgcgcacttttccccgatg
ggttttgatgacgatgaccgactgtggccgaaaggtgagtcagcgttcagcggctaccag
ttgttgctggaatatttcaccttccgtgagaagtttatgtttgtggcgctgaacgggctg
gagaacgtcatctggccggaaaggataaccggctttgagattgacgtggtgctggcggaa
aactggcctcatgatttgccgtttaataccgacaatctccgcctgcactgcgtgccggtc
atcaacctgttcccgctcgaagccgatccgttacacctttcgccgctggaaaacgaattt
ctgctgcgcccgatgcgcattcaggacgggcataccgagatttattccgtcgacaacatt
atttcttcgcgccataccggcagtcaggcgtatgtccccttctccagctttcgtcaccgg
ggcgggatgctgcgccacgatgcgccggaacgctattaccacacgcgggtaaagcgcggc
ccttccggcctgcatgacacctggctgattctgggcggcgatgcatttgatactgaccgg
atgctggaggatgaaacgctctctttaagcctgaccggtactaacgggcagcttccccgt
aaggctttacagagcacgctgctcgatacgccagttcatgcctcacagaacgtcctgcgg
gtgcgcaacctgtgcgctccgacgcagccctgctatccccctgcgcgtgaccgcttccac
tggcgggtgctcagtcaccttggttctaactttttatcgatgatggataacgccgaaatt
ctgcgcggcacgctggcactgtacgactggaccgaaagcgagatgaaccgccgtcgtctg
gaggcgattgtcgacgttcagcacagcctgatacagcgttttgaaagaggctttctgctg
cgtggcgtggatattcaggtgacgctggacagtaacggctttgccggagaaggtgatatc
acgctgtttggtgaactgctgcaccgctttttcgcactgtatgccgatatccacttattc
actcaactgaccttaattctgcaacccacaggaaagtgcctgcaatggacagagcatcac
agccagcgcgtaccgggctga

DBGET integrated database retrieval system