KEGG   Escherichia coli O83 H1 NRG 857C (AIEC): NRG857_13885
Entry
NRG857_13885      CDS       T02068                                 

Definition
(RefSeq) hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
eln  Escherichia coli O83:H1 NRG 857C (AIEC)
Brite
KEGG Orthology (KO) [BR:eln00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eln02044]
    NRG857_13885
Secretion system [BR:eln02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   NRG857_13885
SSDB
Motif
Pfam: VasL ImpA_N FTA4
Other DBs
NCBI-GeneID: 12877626
NCBI-ProteinID: YP_006121123
UniProt: A0A0H3EKR9
Position
2927560..2928936
AA seq 458 aa
MASNANFISQFVMGGDPCTYKESGELQAEMSKLTHPARPDVDWRQVEKLCLALFRQNGVE
LQTLVCYVLAITRRQGLAGMADGLGSLDILLQRWADFWPVQVHSRISLLSWVTEKMQQAL
RTLDIQYQDLPQIYRCVQHLSAIETTLQQCELWHMTKLDLLAGQFRNTALRLERLAPQGA
ETTITPPELPRREMNQPKKSEESPQPVFATRSVQQNDKDASPPVPSPEISRQRTWPIFMA
GMVVMAGLGGTGLWGWSQLNQPDALIQRIQLSVMPLPLSLESGELAKLDVKDKALLAQDR
TIAASQMQLEQLNKLPARWPLEQGYRQLRQLDALWPDNPQVRALNAQWRKQRELSALSAE
ALNGYAQAQSQLQRLSAQLDALDERKGRYLTGSELKTAVYGIRQSLKEPPLEELLRQLEE
QKQTGEVSPTLLTQIDTRLNQLLNRYVILLDTKVEQSQ
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggcaagtaacgcgaattttatcagccagttcgtcatgggcggcgatccctgtacttat
aaggaatccggtgaactgcaggctgaaatgagtaaactgactcacccggcccgaccggat
gtggactggcgtcaggtggaaaaactctgcctcgcgctgttccggcaaaatggcgtggaa
ctacagacgctggtctgttacgtactggcgataaccagacggcaggggctggcagggatg
gcagacggactcggttcactggatatactgctccagcgctgggctgacttctggccggta
caggtacattccagaatatcactgctcagctgggtcacagaaaaaatgcagcaggcactg
agaacgctggatattcagtatcaggatctgccgcagatctaccgttgtgtacagcatctt
tccgccatcgaaaccacgctgcaacagtgtgaactgtggcatatgacgaaactggatcta
ctggccgggcagtttcgcaataccgcattgcgtctggaacggctggcgcctcagggagcg
gaaaccactatcactccccctgaattaccccgccgggaaatgaatcaaccgaaaaagtca
gaggaaagtccacagccggtttttgcaaccagatccgttcagcaaaacgataaggatgcc
agtccacccgttccatcccctgaaatctcccggcagcggacatggccgatatttatggcc
ggaatggttgtgatggccggtctcggcggaacaggattatggggctggtcgcagcttaat
cagccggacgcgctaatccagcgaatacaactgtctgtcatgccgttgccgctgtcgctg
gagagcggcgaactggcaaagctggatgtaaaggataaggcgctgctggctcaggacaga
acaattgcggcaagtcagatgcaactggagcagttaaacaaattgcctgcccgctggcca
ctggagcagggatatcgccagctacgccagcttgatgccctgtggccggataatcctcag
gtcagggcgctgaacgcgcagtggcgcaaacagcgggagctgagcgccctgtctgctgag
gcactgaatggctatgctcaggcgcagagccagctacagcgcctgtcggcgcagctggat
gcactggatgaacgtaaggggagatatctgaccggttcggaactaaaaacggcggtgtac
ggcatccggcagtcgttaaaggagccgccgctggaagaactgcttcggcaactggaagag
caaaaacagaccggagaggtttcgccaacgctgttgacgcaaattgatacccggttaaat
cagttgttgaatcgctatgtcattttactggatacgaaggtggaacaaagtcagtaa

DBGET integrated database retrieval system