KEGG   Escherichia coli O83 H1 NRG 857C (AIEC): NRG857_14075
Entry
NRG857_14075      CDS       T02068                                 

Definition
(RefSeq) xanthine dehydrogenase subunit XdhC
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
eln  Escherichia coli O83:H1 NRG 857C (AIEC)
Pathway
eln00230  Purine metabolism
eln01100  Metabolic pathways
eln01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eln00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NRG857_14075
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-GeneID: 12877666
NCBI-ProteinID: YP_006121162
UniProt: A0A0H3EP53
Position
2978897..2979376
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGMPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLFLAAWAEGKEIRTLEGEAKGGKLSHVQLAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcgccaggaatgccgctttcggaactactccgagaacaagggcttcttagtgtc
aaacaaggttgctgcgtaggcgaatgcggtgcctgtacggtgctggtcgacggcactgcg
atagacagttgcttattccttgcggcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggtaaactttctcatgtccaactggcttatgcgaaatctggtgca
gtgcaatgcgggttttgtacgccgggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgtggactggcgggaaatctttgt
cgctgcacagggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system