KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17355Help
Entry
NRG857_17355      CDS       T02068                                 

Definition
(RefSeq) oligopeptidase A
  KO
K01414  oligopeptidase A [EC:3.4.24.70]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Brite
KEGG Orthology (KO) [BR:eln00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:eln01002]
    NRG857_17355
Enzymes [BR:eln01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.70  oligopeptidase A
     NRG857_17355
Peptidases [BR:eln01002]
 Metallo Peptidases
  Family M3
   NRG857_17355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M3
Motif
Other DBs
NCBI-GeneID: 12876433
NCBI-ProteinID: YP_006121813
UniProt: A0A0H3EQS4
Position
complement(3658777..3660819)
Genome map
AA seq 680 aa AA seqDB search
MTNPLLTPFELPPFSKILPEHVVPAVTKALNDCRENVERVVAQGAPYTWENLCQPLAEVD
DVLGRIFSPVSHLNSVKNSPELREAYEQTLPLLSEYSTWVGQHEGLYKAYRDLRDGDHYA
TLNTAQKKAVDNALRDFELSGIGLPKEKQQRYGEIATRLSELGNQYSNNVLDATMGWTKL
VTDEAELAGMPESALAAAKAQAEAKELEGYLLTLDIPSYLPVMTYCDNQALREEMYRAYS
TRASDQGPNAGKWDNSKVMEEILALRHELAQLLGFENYAFKSLATKMAENPQQVLDFLTD
LAKRARPQGEKELAQLRAFAKAEFGVDELQPWDIAYYSEKQKQHLYSISDEQLRPYFPEN
KAVNGLFEVVKRIYGITAKERNDVDVWHPDVRFFELYDENNELRGSFYLDLYARENKRGG
AWMDDCVGQMRKADGSLQKPVAYLTCNFNRPVNGKPALFTHDEVITLFHEFGHGLHHMLT
RIETAGVSGISGVPWDAVELPSQFMENWCWEPEALAFISGHYETGEPLPKELLDKMLAAK
NYQAALFILRQLEFGLFDFRLHAEFRPDQGAKILETLAEIKKLVAVVPSPSWGRFPHAFS
HIFAGGYAAGYYSYLWADVLAADAFSRFEEEGIFNRETGQSFLDNILSRGGSEEPMELFK
RFRGREPQLDAMLEHYGIKG
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatccgttactgactccctttgaattgcctccgttttctaaaattctcccggaa
catgtcgttccagccgtgactaaggcgctgaacgactgccgcgaaaatgtggagcgcgta
gtagcgcaaggggcaccgtacacctgggaaaatctctgccagccgttggcggaagtggac
gatgtgctggggcgtatcttctccccggtcagccatctgaactcggtgaaaaatagcccg
gaactgcgtgaagcgtacgaacaaaccctgccgctgctgtcagaatacagcacctgggta
gggcaacatgaagggctgtataaggcatatcgcgacctgcgtgatggcgatcattacgcc
acgctgaacacggcgcagaaaaaagcggttgataacgcactgcgcgacttcgaactctct
ggcatcggtctgccgaaagagaaacagcagcgttacggcgaaattgctacccgtctttct
gaactgggcaatcagtacagcaacaacgtcctcgatgcgacgatgggctggaccaaactc
gttaccgacgaagcggagctggcggggatgccagaaagcgcgctggctgcggcaaaagcc
caggccgaagcgaaagagctggaaggttatttgctgacgctggatatcccaagctacctg
ccggtaatgacctactgcgacaaccaggccctgcgtgaagagatgtatcgcgcttatagc
actcgtgcttccgatcaaggtccgaacgccggtaagtgggacaacagcaaggtgatggaa
gagatcctcgcgctgcgtcacgaactggcgcaactgctgggctttgaaaactacgccttc
aaatcacttgccactaaaatggcagaaaacccgcagcaggtgctggatttcttaaccgat
ctggcaaaacgcgcgcgcccgcaaggcgaaaaagagctggcgcaactgcgcgccttcgcc
aaagccgaatttggcgtcgatgagttgcaaccgtgggatattgcttactacagcgaaaaa
cagaaacagcacctctacagcatcagcgatgaacaactgcgtccgtacttcccggaaaac
aaagcggttaacggcctgtttgaagtggtgaaacgtatttacggcatcaccgctaaagag
cgtaacgatgttgatgtctggcatccggatgtacgtttcttcgaactgtatgacgagaac
aacgaactgcgcggcagcttctacctcgacctgtatgcccgtgaaaacaaacgtggcggg
gcgtggatggatgactgcgtaggccagatgcgtaaagccgacggttcgctgcaaaaaccg
gtcgcgtatctgacctgcaacttcaaccgcccggtaaatggtaaaccggcgctgtttacc
catgacgaagtgatcaccctgttccacgagttcggtcacggcctgcaccatatgctgacc
cgcattgaaaccgctggtgtttccgggatcagtggggtgccgtgggatgcggtcgaactg
ccgagccagtttatggaaaactggtgctgggagccggaggcgctggcgtttatctccggt
cactatgaaaccggcgagccgctgccgaaggagctgctggataaaatgctggcggcgaag
aactaccaggcggcgctgtttattctgcgccagctggagttcggcctgttcgatttccgc
ctccatgcagagttccgtccggatcagggggcgaaaatcctcgaaactctggcagaaatc
aagaaactggttgccgtggtaccgtctccgtcatggggccgtttcccgcatgctttcagc
cacatttttgccggtggttatgcggcaggttactacagctacctgtgggccgatgtgctg
gcggcagatgccttctcgcgttttgaggaagagggcattttcaaccgtgaaactgggcaa
tcgttcctcgacaacattctgagccgtggcggttcagaagagccgatggagctgttcaaa
cgcttccgtggtcgtgaaccacagctggatgcgatgctggagcattacggcattaagggc
tga

DBGET integrated database retrieval system