KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17370Help
Entry
NRG857_17370      CDS       T02068                                 

Definition
(RefSeq) arsenate reductase
  KO
K00537  arsenate reductase [EC:1.20.4.1]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Brite
Enzymes [BR:eln01000]
 1. Oxidoreductases
  1.20  Acting on phosphorus or arsenic in donors
   1.20.4  With disulfide as acceptor
    1.20.4.1  arsenate reductase (glutaredoxin)
     NRG857_17370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArsC PGM_PMM_IV Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 12876436
NCBI-ProteinID: YP_006121816
UniProt: A0A0H3EQ58
Position
3663760..3664185
Genome map
AA seq 141 aa AA seqDB search
MSNITIYHNPACGTSRNTLEMIRNSGTEPTIIYYLETPPTRDELVKLIADMGITVRALLR
KNVEPYEKLGLAEDKFTHDQLIDFMLQHPILINRPIVVTPQGTRLCRPSEVVLEILPDAQ
KGAFTKEDGEKVVDEAGNRLK
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacattaccatttatcacaacccggcctgcggtacgtcgcgtaatacgctggag
atgatccgcaacagcggtacagaaccaaccattatctattatctggaaacaccaccgacg
cgcgatgagctggtaaaactcattgccgatatggggattaccgtacgcgcgttgctgcgt
aaaaacgtcgagccgtatgagaaactgggccttgcagaagataaatttactcacgatcag
ttaatcgactttatgcttcagcacccgattctgattaatcgcccgattgtggtgacgcca
cagggaactcgcctgtgccgcccttcagaagtcgtgctggaaattctgccagatgcgcaa
aaaggcgcgttcaccaaggaagatggcgagaaagtggttgatgaggcgggtaatcgcctg
aaataa

DBGET integrated database retrieval system