KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17380Help
Entry
NRG857_17380      CDS       T02068                                 

Definition
(RefSeq) putative DNA-binding transcriptional regulator
  KO
K21901  LuxR family transcriptional regulator, dicarboxylate transport regulator
Organism
eln  Escherichia coli O83:H1 NRG 857C
Brite
Transcription factors [BR:eln03000]
 Prokaryotic Type
  Helix-turn-helix
   LuxR family
    NRG857_17380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GerE DUF1492
Motif
Other DBs
NCBI-GeneID: 12876438
NCBI-ProteinID: YP_006121818
UniProt: A0A0H3EQS8
Position
3666088..3666618
Genome map
AA seq 176 aa AA seqDB search
MFLIITRDTMFFTAMKNILSKGNVVHIQNEEEIDVMLHQNAFVIIDTLMNNVFHSNFLTQ
IERLKPVHVIIFSPFNIKRCLGKVPVTFVPRTIAIIDFVALINGSYCSVPEADVSLSRKQ
HQVLSCIANQMTTEDILEKLKISLKTFYCHKHNIMMILNLKRINELVRHQHINYLV
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttataattaccagggatacgatgtttttcaccgcgatgaaaaacattctgagt
aaaggtaatgtcgttcatatacagaacgaagaagagatcgacgtaatgttgcatcagaat
gccttcgtcattattgatacattaatgaataatgtatttcattctaattttctcactcaa
attgaacgattaaaacctgtccatgtaattattttctccccctttaatattaaacgctgc
ctggggaaagtaccggtgacctttgttccgcgaactatcgccatcatcgactttgtcgca
ctcatcaatggcagttactgctctgtgcctgaagcggatgtgtccctctcgcgcaagcag
catcaggttctgagctgtattgcgaatcaaatgacaacggaagatattctggagaaactg
aaaatatcgctaaaaacgttctactgccataaacacaatatcatgatgatcctcaatctt
aagcggatcaatgagctggtacgccatcagcatattaattatctggtgtga

DBGET integrated database retrieval system