KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17385Help
Entry
NRG857_17385      CDS       T02068                                 

Definition
(RefSeq) heme oxygenase
  KO
K07225  putative hemin transport protein
Organism
eln  Escherichia coli O83:H1 NRG 857C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HemS ChuX_HutX
Motif
Other DBs
NCBI-GeneID: 12876439
NCBI-ProteinID: YP_006121819
UniProt: A0A0H3EN19
Structure
PDB: 

Position
complement(3666675..3667703)
Genome map
AA seq 342 aa AA seqDB search
MNHYTRWLELKEQNPGKYARDIAGLMNISEAELAFARVTHDAWRMRGDIREILAALESVG
ETKCICRNEYAVHEQVGAFTNQHLNGHAGLILNPRALDLRLFLNQWASVFHIKENTARGE
RQSIQFFDHQGDALLKVYATDNTDMAAWSELLARFITDENTPLELKAVDAPVVQTRADAS
VVEQEWRAMTDVHQFFTLLKRHNLTRQQAFNLVADDLACKVSNSALAQILESAQQDGNEI
MVFVGNRGCVQIFTGVVEKVVPMKGWLNIFNPTFTLHLLEESIAEAWVTRKLTSDGHVTS
LELFAHDGTQIAQLYGQRTEGEQEQAQWRKQIASLIPEGVTA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaccactacacacgctggcttgagttaaaagaacaaaatcccggaaagtacgcgcgt
gacatcgcaggtttaatgaatatcagcgaagcagaactggcatttgcacgcgtcacgcac
gatgcgtggcggatgcgcggcgatatccgtgaaattctggcggcgctcgaaagtgttggc
gagaccaaatgtatttgccgtaatgaatacgcagtccatgaacaagttggtgcgttcaca
aaccagcatttgaacggacatgccggattgatcctcaatccgcgcgcgctggatttacgt
ctgtttctcaatcaatgggccagtgttttccacatcaaagaaaacacggctcgtggcgaa
cgccagagtattcagttctttgatcatcagggcgatgcattactaaaagtttatgccacc
gacaataccgatatggcggcatggagtgagcttctggcacggtttatcaccgatgagaat
acgccgcttgagttaaaagccgttgatgcgccagttgttcaaacgcgagccgatgccagt
gtggtcgagcaagagtggcgggcgatgaccgacgttcatcagttttttacgttgctcaag
cgccacaacctgacgcgccaacaggcgttcaatctggtggcagacgatttggcctgcaaa
gtatccaacagtgcgttggcgcaaattcttgaatctgcacagcaggatggcaatgaaatc
atggtgtttgttggcaaccgtggctgcgtacagattttcaccggtgtggtagaaaaagtg
gtgccaatgaaaggttggctgaatattttcaacccgacgtttacccttcatctattagaa
gagagcattgctgaagcctgggttacccgtaaactgaccagcgatggccacgtaaccagc
ctggaattgtttgcccatgatggtacgcagatagcgcaactttatggtcaacgtacagaa
ggtgaacaggagcaagcgcaatggcgtaagcaaattgcttcgttgataccggaaggcgtt
actgcataa

DBGET integrated database retrieval system