KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17390Help
Entry
NRG857_17390      CDS       T02068                                 

Definition
(RefSeq) outer membrane heme/hemoglobin receptor
  KO
K16087  hemoglobin/transferrin/lactoferrin receptor protein
Organism
eln  Escherichia coli O83:H1 NRG 857C
Brite
KEGG Orthology (KO) [BR:eln00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eln02000]
    NRG857_17390
Transporters [BR:eln02000]
 Other Transporters
  Pores ion channels [TC:1]
   NRG857_17390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_dep_Rec Plug
Motif
Other DBs
NCBI-GeneID: 12876440
NCBI-ProteinID: YP_006121820
UniProt: A0A0H3EN59
Position
complement(3667752..3669734)
Genome map
AA seq 660 aa AA seqDB search
MSRPQFTSLRLSLLALAVSATLPTFAFATETMTVTATGNARSSFEAPMMVSVIDTSAPEN
QTATSATDLLRHVPGITLDGTGRTNGQDVNMRGYDHRGVLVLVDGVRQGTDTGHLNGTFL
DPALIKRVEIVRGPSALLYGSGALGGVISYDTVDAKDLLQEGQSSGFRVFGTGGTGDHSL
GLGASAFGRTENLDGIVAWSSRDRGDLRQSNGETAPNDESINNMLAKGTWQIDSAQSLSG
LVRYYNNDAREPKNPQTVEASDSSNPMVDRSTIQRDAQLSYKLAPQGNDWLNADAKIYWS
EVRINAQNTGSSGEYREQITKGARLENRSTLFADSFASHLLTYGGEYYRQKQHPGGATTG
FPQAKIDFSSGWLQDEITLRDLPITLLGGTRYDSYRGSSDGYKDVDADKWSSRAGMTINP
TNWLMLFGSYAQAFRAPTMGEMYNDSKHFSIGRFYTNYWVPNPNLRPETNETQEYGFGLR
FDDLMLSNDALEFKASYFDTKAKDYISTTVDFAAATTMSYNVPNAKIWGWDVMTKYTTDL
FSLDVAYNRTRGKDTDTGEYISSINPDTVTSTLNIPIAHSGFSVGWVGTFADRSTHISSS
YSKQPGYGVNDFYVSYQGQQALKGMTTTLVLGNAFDKEYWSPQGIPQDGRNGKIFVSYQW
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtccgcaatttacctcgttgcgtttgagtttgttggctttggctgtttctgcc
accttgccaacgtttgcttttgctactgaaaccatgaccgttacggcaacggggaatgca
cgtagttccttcgaagcgcctatgatggtcagcgttatcgacacttccgctcctgaaaat
caaactgctacttcagccactgatttgctgcgtcatgttcctggaattactcttgatggt
accggacgaaccaacggtcaggatgtaaatatgcgtggctatgatcatcgcggcgtgctg
gttcttgtcgatggtgttcgccagggaacggataccggacacctgaatggcacttttctc
gatccggcgctgatcaagcgtgttgagattgttcgcggaccttcagcattactgtatggc
agtggcgcgctgggtggagtgatctcctacgatacggtcgatgcaaaagatttattgcag
gaaggacaaagcagtggttttcgtgtctttggtactggcggcacgggggaccatagcctg
ggattaggcgcgagcgcgtttgggcgaactgaaaatctggatggtattgtggcctggtcc
agtcgcgatcggggtgatttacgccagagcaatggtgaaaccgcgccgaatgacgaatcc
attaataacatgctggcgaaagggacctggcaaattgattcagcccagtctctgagcggt
ttagtgcgttactacaacaacgacgcgcgtgaaccaaaaaatccgcagaccgttgaagct
tctgatagcagcaacccgatggtcgatcgttcaacaattcaacgcgatgcgcagctttct
tataaactcgccccgcagggtaacgactggttaaatgcagatgcaaaaatttactggtcg
gaagtccgtattaatgcgcaaaacacggggagttcaggcgagtatcgtgaacagataaca
aaaggagcaaggctggagaaccgttccactctatttgccgacagtttcgcttctcactta
ctgacatatggcggtgagtattatcgtcagaaacaacatccgggtggcgcgacgacgggc
ttcccgcaagcaaaaatcgattttagctctggctggctacaagatgagatcaccttacgc
gatctgccgattaccctgcttggcggaacccgctatgacagttatcgcggtagcagcgac
ggctacaaagatgttgatgccgacaaatggtcatctcgtgcggggatgactatcaacccg
accaactggctgatgttatttggctcatatgctcaggcattccgcgccccgacgatgggc
gaaatgtataacgattctaaacacttctcgattggtcgcttctataccaactattgggtg
ccaaacccgaacttacgtccggaaactaacgaaactcaggagtacggttttgggctgcgt
tttgatgacctgatgttgtccaatgatgctctggaatttaaagccagctactttgatacc
aaagcgaaagattatatctccacgaccgtcgatttcgcggcggcgacaactatgtcgtat
aacgtcccgaacgccaaaatctggggctgggatgtgatgacgaaatataccactgatctg
tttagccttgatgtggcctataaccgtacccgcggcaaagacaccgataccggggaatat
atctccagcattaacccggataccgttaccagtaccctgaatattccgatcgctcacagt
ggcttctctgttggttgggtcggtacgtttgccgatcgctcaacacatatcagcagcagc
tacagcaaacaacctggctatggtgtgaatgatttctacgtcagttatcaagggcagcag
gcgctcaaaggcatgaccactactctggtattgggcaacgccttcgataaagagtactgg
tcgccgcaaggcatcccacaggatggtcgtaacggaaaaattttcgtgagttatcaatgg
taa

DBGET integrated database retrieval system