KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17395Help
Entry
NRG857_17395      CDS       T02068                                 

Definition
(RefSeq) putative periplasmic binding protein ChuT
  KO
K02016  iron complex transport system substrate-binding protein
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln02010  ABC transporters
Module
eln_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:eln00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NRG857_17395
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eln02000]
    NRG857_17395
Transporters [BR:eln02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    NRG857_17395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_2 DUF148
Motif
Other DBs
NCBI-GeneID: 12876441
NCBI-ProteinID: YP_006121821
UniProt: A0A0H3EQ64
Position
3670418..3671332
Genome map
AA seq 304 aa AA seqDB search
MPRIITRPFLFSPLTLCISAVVSAAKTMVKRKKLFTALLALSWTFSVTAAERIVVAGGSL
TELIYAMGAGKRVVGVDETTSYPPETAKLPHIGYWKQLSSEGILSLRPDSVITWQDAGPQ
IVLDQLRAQKVNVVTLPRVPATLEQMYANIRQLAKTLQVPEQGEALVTQINQRLERVQQN
VAAKKAPVKAMFILSAGGSAPQVAGKGSVADAILSLAGAENVATHQQYKSYSAESLIAAN
PEVIVVTSQMVDGDINRLRSIAGITHTAAWKNQRIITVDQNLILGMGPRIADVVESLHQQ
LWPQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgccaaggatcatcaccaggccgtttcttttttccccactaacgttatgtatttcagcc
gtggtctctgccgcgaagaccatggtaaaacgaaaaaaattgtttacggcattactggct
cttagctggacttttagcgtaacggctgccgaacgtatcgtggtcgcaggaggatcgctg
acggagctaatctacgcgatgggcgctggcaaacgcgtggttggtgtcgatgaaacgaca
tcttatccaccagaaaccgccaaactgccgcatattggttactggaaacaactcagcagc
gaaggcattttgtcacttcgcccggatagcgtaattacctggcaggatgcaggaccgcaa
attgtgctcgaccaactgcgggcgcaaaaagtcaacgtcgtcactctgccgcgtgtacca
gccacccttgagcagatgtacgccaacattcgccaactggcaaaaacgttacaggttcct
gaacaaggcgaggcgctggtgacacagatcaaccaacgcctggagcgagtacagcaaaac
gtggcggccaaaaaagccccggttaaagccatgtttattctctccgcaggcggaagtgcg
ccacaggttgccggtaaaggcagcgtcgcggacgccattctttcgcttgccggagcagaa
aacgtcgctacccaccagcagtacaaaagctacagcgcggaatcgctgattgcggctaac
cctgaagtgattgtcgtcacctcacaaatggtcgatggcgatattaatcggctacgttct
attgccggaattacccacactgccgcatggaaaaaccagcgcattatcaccgttgatcaa
aacctgattctgggaatgggtccgcgtattgctgatgtcgttgagtctttacaccagcag
ctttggccgcaataa

DBGET integrated database retrieval system