KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17415Help
Entry
NRG857_17415      CDS       T02068                                 

Definition
(RefSeq) putative hemin transport system permease
  KO
K02015  iron complex transport system permease protein
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln02010  ABC transporters
Module
eln_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:eln00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NRG857_17415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eln02000]
    NRG857_17415
Transporters [BR:eln02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    NRG857_17415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD
Motif
Other DBs
NCBI-GeneID: 12876445
NCBI-ProteinID: YP_006121825
UniProt: A0A0H3EN62
Position
3673904..3674860
Genome map
AA seq 318 aa AA seqDB search
MGLSLLLLALVLFGASQGALKISFDALFDEEYRDIWLNIRLPRVLLAVLVGAALATAGVI
MQGLFRNPMADPGLLGVSSGSALMVGVAIVLPFSFPVVLVLYEQMVFAIAGSLVVCTIIF
LITQRHRDGSMMQLLLAGIAINALCGAAIGILSYIGDEQQLRQLTLWMMGNLGQAQWPTL
LVASSFILPAIIATTCLAGTLNLLQLGDEEAHYLGVNVKRKRQQLLLVSSLLVGAAVSVS
GIIGFIGLVIPHLIRMTTGANHRWLIPCSALAGACLLLMADTLARTLVQPAEMPVGLLTS
LLGGPYFMWLILRNRRIT
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggggctatcactattattgctagctctggtgctgtttggtgccagtcagggagcgtta
aagatcagttttgatgccctttttgatgaggaataccgcgatatctggctcaatattcgt
ctaccacgggttttgctggcggtgctggtaggtgcagcgttggcaaccgccggggtaatt
atgcaggggctttttcgcaacccaatggctgaccctggattactcggcgtcagtagcggt
tctgcattaatggttggcgttgctattgtgctgcccttctccttcccagtggtgctggtg
ctctatgagcaaatggtgtttgccattgccggaagtttagtggtctgcaccatcattttt
ctcatcacgcagcgccatcgcgatggcagcatgatgcaattattactcgccggtatcgcc
atcaatgccctgtgcggcgcagcgatcggcatcctgagctatatcggcgatgagcagcag
ctacgacaactcacattgtggatgatgggcaatcttggacaggcgcaatggccgacgtta
ttggttgccagttcattcatcctaccggccattatcgcaacaacttgtctcgccggaacg
ctgaatttactgcagctcggtgatgaagaagcccactacctcggcgtgaacgtgaagcgt
aaacgccagcaattactgttagtgagctcactgctcgttggtgctgccgtatcggtaagc
ggcattatcggctttattggcctggtgatcccgcatctgattcgcatgactaccggggca
aatcaccgctggctaatcccttgttccgccctcgccggagcctgtttattgctgatggca
gacacgcttgcccgcacgctggtacagccagcagaaatgcccgtgggattattaaccagc
ctgcttggtggcccttattttatgtggttaattctgcgcaaccggaggatcacatga

DBGET integrated database retrieval system