KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17425Help
Entry
NRG857_17425      CDS       T02068                                 

Definition
(RefSeq) putative Mg(2+) transport ATPase
  KO
K07507  putative Mg2+ transporter-C (MgtC) family protein
Organism
eln  Escherichia coli O83:H1 NRG 857C
Brite
KEGG Orthology (KO) [BR:eln00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eln02000]
    NRG857_17425
Transporters [BR:eln02000]
 Other Transporters
  Others
   NRG857_17425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MgtC
Motif
Other DBs
NCBI-GeneID: 12876447
NCBI-ProteinID: YP_006121827
UniProt: A0A0H3EMT5
Position
complement(3675679..3676326)
Genome map
AA seq 215 aa AA seqDB search
MTAEFIIRLILAVIVCGAIGMERQMRGKGAGLRTHVLIGMGSALFMIVSKYGFADVLSLG
HVGLDPSRIAAQVVTGVGFIGAGNILVRNQNIVGLTTAADIWVTAAIGMVIGSGMYELGI
YGSVMTLLVLEVFHQLTFRLMNKNYHLQLTLVNGNTVSMLDWFKQQKIKTDLVSLQENED
HEVVAIDIQLHATTSIEDLLRLLKGMAGVKGVSIS
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagaatttattatacgacttatacttgcggtaattgtctgtggcgctattggc
atggaaaggcaaatgcgcggcaaaggagcagggttacgcacacatgtattaattggcatg
ggaagcgccttgtttatgattgtttcgaaatatggttttgctgacgtgctgtctttaggt
cacgtcggactggatcccagccgtattgctgctcaggttgtgacgggcgtcgggtttatc
ggtgcaggtaacattctcgttcgtaaccaaaatattgtaggtctgacgacggcagcggat
atctgggtgaccgccgccattggtatggttattggcagcggtatgtacgaactgggtatt
tatggttcagtgatgaccttgctggtgctggaagtcttccatcaattaaccttccgcctg
atgaacaaaaattaccatttacagctgacattagtgaacggtaatacggtatcaatgctc
gactggtttaagcagcaaaaaataaaaacggatttagtttcgttgcaggaaaatgaagat
catgaagtggtcgccattgatatccagcttcatgccacgacgtcgatagaagatctgttg
cgattattaaaaggtatggcaggggtgaaaggcgtttcaattagctaa

DBGET integrated database retrieval system