KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17435Help
Entry
NRG857_17435      CDS       T02068                                 

Definition
(RefSeq) acid-resistance protein
  KO
K19777  acid stress chaperone HdeA
Organism
eln  Escherichia coli O83:H1 NRG 857C
Brite
KEGG Orthology (KO) [BR:eln00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:eln03110]
    NRG857_17435
Chaperones and folding catalysts [BR:eln03110]
 Other chaperones and cochaperones
  Others
   NRG857_17435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HdeA
Motif
Other DBs
NCBI-GeneID: 12876449
NCBI-ProteinID: YP_006121829
UniProt: A0A0H3EN29
Structure
PDB: 

Position
complement(3676832..3677164)
Genome map
AA seq 110 aa AA seqDB search
MKKVLGVILGGLLLLPVVSNAADAQKAADNKKPVNSWTCEDFLAVDESFQPTAVGFAEAL
NNKDKPEDAVLDVQGIATVTPAIVQACTQDKKASFKDKVKGEWDKIKKDM
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtattaggcgttattcttggtggtctgcttcttctgccagtagtgagcaat
gcagcggatgcacaaaaagcagctgataacaaaaaaccggtcaactcctggacctgtgaa
gatttcctggctgtggacgaatccttccagccaactgcagttggttttgctgaagcactg
aacaacaaagataaaccagaagatgcggttttagatgttcagggtattgcaaccgtaacc
ccagctatcgttcaggcttgtactcaggataaaaaagccagctttaaagataaagttaaa
ggcgaatgggacaaaattaagaaagatatgtaa

DBGET integrated database retrieval system