KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17445Help
Entry
NRG857_17445      CDS       T02068                                 

Definition
(RefSeq) putative DNA-binding transcriptional activator
  KO
K21907  LuxR family transcriptional regulator, glutamate-dependent acid resistance regulator
Organism
eln  Escherichia coli O83:H1 NRG 857C
Brite
KEGG Orthology (KO) [BR:eln00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eln03000]
    NRG857_17445
Transcription factors [BR:eln03000]
 Prokaryotic Type
  Helix-turn-helix
   LuxR family
    NRG857_17445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GerE AP_endonuc_2
Motif
Other DBs
NCBI-GeneID: 12876451
NCBI-ProteinID: YP_006121831
UniProt: A0A0H3EQ74
Position
3678790..3679317
Genome map
AA seq 175 aa AA seqDB search
MIFLMTKDSFLLQGFWQLKDNHEMIKINSLSEIKKVGNKPFKVIIDTYHNHILDEEAIKF
LEKLDAERIIVLAPYHISKLKAKAPIYFVSRKESIKNLLEITYGKHLPHKNSQLCFSHNQ
FKIMQLILKNKNESNITSTLNISQQTLKIQKFNIMYKLKLRRMSDIVTLGITSYF
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgatttttctcatgacgaaagattcttttcttttacagggcttttggcagttgaaagat
aatcacgaaatgataaaaatcaattccctgtcagagatcaaaaaagtaggcaataaaccc
ttcaaggtgatcattgacacctatcacaaccatatccttgatgaagaagcgattaaattc
ctggagaaattagatgccgagagaattattgttttggcaccttatcacatcagtaaacta
aaagctaaagcgcctatttattttgtcagccgtaaagaaagtatcaaaaatcttcttgag
attacttatggtaaacacttgccccataagaattcacaattatgtttttcacataatcag
ttcaaaattatgcaactgattctgaaaaacaaaaatgaaagcaatatcacgtcaacgctc
aacatttcgcaacaaacattaaagattcagaaattcaacattatgtacaagctgaaatta
agacgtatgagcgacatcgtcaccctgggtatcacatcttatttttag

DBGET integrated database retrieval system