KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17465Help
Entry
NRG857_17465      CDS       T02068                                 

Definition
(RefSeq) DNA-binding transcriptional activator
  KO
K21906  AraC family transcriptional regulator, glutamate-dependent acid resistance regulator
Organism
eln  Escherichia coli O83:H1 NRG 857C
Brite
KEGG Orthology (KO) [BR:eln00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eln03000]
    NRG857_17465
Transcription factors [BR:eln03000]
 Prokaryotic Type
  Helix-turn-helix
   AraC family
    NRG857_17465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC
Motif
Other DBs
NCBI-GeneID: 12876455
NCBI-ProteinID: YP_006121835
UniProt: A0A0H3EN70
Position
complement(3684314..3685042)
Genome map
AA seq 242 aa AA seqDB search
MAHVCSVILVRRSFDIHHEQQKISLHNESILLLDKNLADDFAFCSLDTRRLDIEELTVCH
YLQNIRQLPRNLGLHSKDRLLINQSPPIQLVTAIFDSFNDPRVNSPILSKMLYLSCLSMF
SHKKELIPLLFNSISTVSGKVERLISFDIAKRWYLRDIAERMYTSESLIKKKLQDENTCF
SKILLASRMSMARRLLELRQIPLHTIAEKCGYSSTSYFINTFRQYYGVTPHQFSQHSPGT
FS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggctcatgtctgctcggtgatcctcgttcgtcgttcattcgatattcatcatgaacag
caaaaaatatcgttgcataacgagagtatcctgctgctggataaaaatttggcagacgat
tttgcgttttgttcactggatacgcgacggctggatatcgaagagctgacagtttgccat
tacttacaaaatattcgtcagttgccacgcaatttaggattgcatagcaaagaccgtttg
ttaattaaccagtcaccccccatacagctggtgacggcgatttttgatagtttcaatgac
ccccgggtcaattcgccgatactgagcaaaatgctctatctttcctgtttatcaatgttt
tctcataagaaagaactgatccccttacttttcaatagtatcagtactgtttcaggaaaa
gttgaacgccttattagctttgatatcgctaaacgttggtatctacgcgatatcgcagaa
agaatgtataccagcgagagtctcatcaaaaaaaagttgcaggatgaaaatacctgtttc
agtaaaatattactcgcctccaggatgtcgatggccagacgattactcgagttacgtcaa
atacctctgcatactattgcggaaaaatgtggctatagcagtacgtcatactttataaat
acatttagacaatattatggtgtaacgccacatcagttttcgcaacattcgccgggtacc
ttttcctga

DBGET integrated database retrieval system