KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_17500Help
Entry
NRG857_17500      CDS       T02068                                 

Definition
(RefSeq) hypothetical protein
  KO
K07058  membrane protein
Organism
eln  Escherichia coli O83:H1 NRG 857C
Brite
KEGG Orthology (KO) [BR:eln00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    NRG857_17500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB Dicistro_VP4
Motif
Other DBs
NCBI-GeneID: 12876462
NCBI-ProteinID: YP_006121842
UniProt: A0A0H3EMU8
Position
3693787..3694800
Genome map
AA seq 337 aa AA seqDB search
MTQENEIKRPTQDLEHEPIKQLDNSEKGGKVSQALETVTTTAEKVQRQPVIAHLIRATER
FNDRLGNQFGAAITYFSFLSMIPILMVSFAAGGFVLASHPMLLQDIFDKILQNISDPTLA
ATLKNTINTAVQQRTTVGLVGLAVALYSGINWMGNLREAIRAQSRDVWERSPQDQEKFWV
KYLRDFISLIGLLIALIVTLSITSVAGSAQQMIISALHLNSIEWLKPTWRLIGLAISIFA
NYLLFFWIFWRLPRHRPRKKALIRGTFLAAIGFEVIKIVMTYTLPSLMKSPSGAAFGSVL
GLMAFFYFFARLTLFCAAWIATAEYKDDPRMPGKTQP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggaaaacgagatcaaacgtcccacccaggatctggagcacgagccgattaag
cagttggataatagcgagaaaggcggcaaagttagccaggcgctggaaaccgtcaccacc
actgccgagaaagtccaacgccaaccggttattgcgcacctgattcgcgcgacagaacgc
tttaacgatcggctgggtaaccagtttggggcggctatcacctatttctcatttttgtcg
atgatccccattttgatggtgtcgtttgccgcagggggctttgtgctggcctcccatccg
atgttgctacaggatatcttcgacaaaattctgcaaaacattagcgatccgacgctagcc
gccacgttgaaaaacaccatcaacaccgccgttcagcagcgtacgactgtagggcttgtc
ggtctggcagtggcgctttattccggcatcaactggatgggtaacctgcgtgaagcgatt
cgcgcccagtcacgcgatgtctgggaacgctcgccgcaagatcaggagaagttctgggta
aaatatctgcgtgattttatttcgctgattggtttgttgattgcgctgattgtgacgctt
tctatcacctcggttgccggttctgcgcagcaaatgattattagcgccctgcacctgaac
agcattgagtggctgaaaccgacatggcggttgattggcctggcgatttccatcttcgcc
aactatctgcttttcttctggatcttctggcggttgccgcgccaccgtccgcgcaaaaaa
gccctgatccgcggaacatttctggctgctattggttttgaagtgattaaaatcgtgatg
acctacaccctgccatcgttgatgaaatcaccctctggcgcagcatttggttccgtgctg
gggctgatggcatttttctacttcttcgcccgtttgacgctgttttgcgcggcgtggatt
gccaccgccgaatataaagacgacccgcgaatgccggggaaaacgcagccttaa

DBGET integrated database retrieval system